KEGG   Bacillus subtilis subsp. subtilis 168: BSU34860Help
Entry
BSU34860          CDS       T00010                                 

Gene name
hisI
Definition
(RefSeq) histidine biosynthesis bifunctional protein HisIE
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00340  Histidine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BSU34860 (hisI)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     BSU34860 (hisI)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     BSU34860 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-GeneID: 936552
NCBI-ProteinID: NP_391366
Pasteur: BG12603
BSORF: BG12603
UniProt: O34912
Position
complement(3582936..3583565)
Genome map
AA seq 209 aa AA seqDB search
MKQADELRFNEDGLIPAIVQDAASKEVLTLAYMNKESYEKTLETKETWFYSRSRQALWHK
GETSGNTQAVKGIRYDCDQDALLVLVEPSGPACHTGSYSCFTKEQTEEQAADRFGIMNEL
ERVIAERQAEMPEGAYTTYLFREGVDKILKKVGEEASEVIIAAKNRDHEELKWEAADLLY
HLLVLLREQSLPLDDVLDVLKKRHSEIEE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggcagatgaactgcgttttaacgaggacggattaattcctgctatcgtgcag
gatgcggcaagcaaagaagtgctgacacttgcgtatatgaacaaggaatcgtacgaaaaa
acgctggaaacgaaggaaacatggttttacagccgctcacgccaagcgttatggcataaa
ggagaaacctcagggaacacgcaagccgtcaaaggtatccggtatgactgcgatcaagac
gcgctgctcgtactcgtagaaccgtcaggcccggcatgccacactggcagctacagctgt
tttacaaaggaacaaacagaagaacaggccgcggaccgattcggcatcatgaacgaactg
gagcgggtgatcgcggaacgccaagcggaaatgcctgaaggagcttacaccacgtacctc
ttccgtgaaggcgtcgataagattttgaaaaaagtcggagaagaagcatccgaagtcatc
atcgccgcgaaaaaccgggatcatgaggaactcaaatgggaagcggcagacctgctgtat
cacctgcttgtcctgctcagagaacaatccctgccgctggatgatgtgcttgacgtattg
aaaaaacgccattctgagattgaagagtaa

DBGET integrated database retrieval system