KEGG   Bacillus subtilis subsp. subtilis 168: BSU34880Help
Entry
BSU34880          CDS       T00010                                 

Gene name
hisA
Definition
(RefSeq) 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
  KO
K01814  phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC:5.3.1.16]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00340  Histidine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BSU34880 (hisA)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.16  1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
     BSU34880 (hisA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_biosynth DHO_dh Dus IMPDH PcrB EAL Ribul_P_3_epim
Motif
Other DBs
NCBI-GeneID: 936580
NCBI-ProteinID: NP_391368
Pasteur: BG12597
BSORF: BG12597
UniProt: O35006
Position
complement(3584317..3585054)
Genome map
AA seq 245 aa AA seqDB search
MSAFTLYPAIDMRNGKCVRLVQGDYNKETIYGDSPYDMAELFEKEGAEWIHLVDLDGAKE
GKRVNDRHVIEIAQKLNLKVEIGGGIRSENDVYEYLSAGVERVILGSSAVSNPPFVKKML
KQYGEKIAIGLDARNGFVSTEGWLETSTLKATELGKELANEGAEVFIFTDIATDGMLSGP
NVKSTVELAKETGKSVIASGGVSSVADLEALARNEADGVSGAIIGKALYTNQFTLSEALE
RVKRK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcttttacattatatccggcaattgatatgagaaacggcaaatgtgttcgcctt
gttcaaggggattataataaggaaacgatatatggcgattcaccgtacgacatggctgag
ttatttgagaaagagggtgccgaatggatccatctcgttgatctcgacggggccaaagaa
gggaaaagagtgaatgaccgccatgtgattgagattgcgcaaaagctgaacctgaaagtc
gaaatcggcggtgggatccgttctgaaaatgacgtctatgaatatttatcagcaggagtc
gagcgggtgatcctgggaagctcagcagtttctaaccctccgtttgtcaaaaaaatgctg
aaacaatatggcgagaaaattgcaatcggactggatgcgagaaacggttttgtttcaaca
gagggatggcttgaaacatcaacccttaaggcaactgaactgggcaaagagctagccaat
gaaggtgcggaagtctttatttttactgacatcgcgacagatggaatgctgtcaggcccc
aatgttaaaagcacggtcgagcttgctaaggaaacggggaaatcggtgatcgcttccggc
ggagtcagctccgtcgcggatctcgaagctctcgcccgcaatgaggcggacggcgtctct
ggagcgatcatcggaaaagcgctgtataccaatcagtttacgctgagtgaggcgcttgaa
agggtgaagcgcaaatga

DBGET integrated database retrieval system