KEGG   Bacillus subtilis subsp. subtilis 168: BSU34890Help
Entry
BSU34890          CDS       T00010                                 

Gene name
hisH
Definition
(RefSeq) imidazole glycerol phosphate synthase subunit HisH
  KO
K02501  imidazole glycerol-phosphate synthase subunit HisH [EC:4.3.2.10]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00340  Histidine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BSU34890 (hisH)
Enzymes [BR:bsu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     BSU34890 (hisH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase GATase_3 SNO DJ-1_PfpI GATase_5
Motif
Other DBs
NCBI-GeneID: 936590
NCBI-ProteinID: NP_391369
Pasteur: BG12602
BSORF: BG12602
UniProt: O34565
Position
complement(3585051..3585689)
Genome map
AA seq 212 aa AA seqDB search
MIGVIDYGMGNLYSVSKALERVGVPYFVSEKPEELKEADAFILPGVGSFGDAMDNLGYTK
LDQLIHDMVSEGRLLLGICLGMQLLFEESEENGTASGLGLLKGKAVRLKAEDEKGNKLKV
PHMGWNRLSFHNESPLLTKTEQGYAYFVHSYYIDGMEENALLASADYGVRVPAVVGKRNV
FGAQFHPEKSSTVGMSILTQFTKMAAEQKVKK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcgtgatagattacggaatggggaatttatacagtgtctcaaaggcgcttgaa
cgtgtcggcgtgccgtattttgtttctgaaaagccggaggagctgaaagaagctgatgct
ttcattttgccgggagtcggttcatttggagacgcgatggacaatttgggctacacgaag
cttgatcaattgattcacgatatggtctcagagggaaggctgcttctcgggatctgcctc
ggcatgcagcttttatttgaagaaagcgaagaaaacggcaccgcttcaggactcgggctg
ttaaaaggaaaagcagtcaggctgaaagcagaagatgaaaaaggaaacaagctgaaggtt
ccgcatatgggctggaatcgtctttcttttcataatgaatctccgctgctgactaaaaca
gaacaaggctacgcttacttcgttcattcctattacattgacgggatggaggagaacgcg
cttctggcaagcgccgattatggtgtacgagtgcctgctgtagtcggaaaaagaaacgtc
ttcggcgcccaatttcatccggaaaaaagcagcacggtcggaatgtctattttaacccaa
tttacgaaaatggcagcagaacagaaggtgaaaaaatga

DBGET integrated database retrieval system