KEGG   Bacillus subtilis subsp. subtilis 168: BSU34900Help
Entry
BSU34900          CDS       T00010                                 

Gene name
hisB
Definition
(RefSeq) imidazoleglycerol-phosphate dehydratase
  KO
K01693  imidazoleglycerol-phosphate dehydratase [EC:4.2.1.19]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00340  Histidine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BSU34900 (hisB)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.19  imidazoleglycerol-phosphate dehydratase
     BSU34900 (hisB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPD DUF1533
Motif
Other DBs
NCBI-GeneID: 936560
NCBI-ProteinID: NP_391370
Pasteur: BG12598
BSORF: BG12598
UniProt: O34683
Position
complement(3585690..3586274)
Genome map
AA seq 194 aa AA seqDB search
MRKAERVRKTNETDIELAFTIDGGGQADIKTDVPFMTHMLDLFTKHGQFDLSINAKGDVD
IDDHHTTEDIGICLGQALLEALGDKKGIKRYGSAFVPMDEALAQVVIDLSNRPHLEMRAD
FPAAKVGTFDTELVHEFLWKLALEARMNLHVIVHYGTNTHHMIEAVFKALGRALDEATTI
DPRVKGIPSTKGML
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcggaacgcgtcaggaaaacaaacgaaacagatattgagctggcatttaca
atagacggcggaggacaagcggatattaaaacagatgtgccgtttatgacacatatgttg
gatttattcacgaaacacggccaatttgatctttccattaacgcaaaaggcgatgttgat
atagatgatcaccacacgactgaagatatcggcatctgcttagggcaggcgctgctcgaa
gcgttgggcgataaaaaaggaatcaaacgctacggatcggcgtttgtgccgatggatgag
gcacttgctcaagttgtgattgatttaagcaaccggccgcacttagaaatgcgcgctgat
ttcccggctgctaaagtcggaactttcgatacggagcttgtacatgaatttttgtggaag
ctggcgctcgaagctcgaatgaacctgcacgtcatcgttcattatggaacaaatacccac
cacatgattgaagccgtttttaaagcactgggacgtgcgcttgatgaagcgacaacgatc
gatccgcgagttaaaggaataccgtcaacgaaagggatgctgtaa

DBGET integrated database retrieval system