KEGG   Bacillus subtilis subsp. subtilis 168: BSU34920Help
Entry
BSU34920          CDS       T00010                                 

Gene name
hisG
Definition
(RefSeq) ATP phosphoribosyltransferase
  KO
K00765  ATP phosphoribosyltransferase [EC:2.4.2.17]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00340  Histidine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BSU34920 (hisG)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.17  ATP phosphoribosyltransferase
     BSU34920 (hisG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisG
Motif
Other DBs
NCBI-GeneID: 936568
NCBI-ProteinID: NP_391372
Pasteur: BG12601
BSORF: BG12601
UniProt: O34520
Structure
PDB: 

Position
complement(3587551..3588192)
Genome map
AA seq 213 aa AA seqDB search
MGKLLTMAMPKGRIFEEAAGLLRQAGYRLPEEFEDSRKLIIDVPEENLRFILAKPMDVTT
YVEHGVADVGIAGKDVMLEEERDVYEVLDLNISKCHLAVAGLPNTDWSGVAPRIATKYPN
VASSYFREQGEQVEIIKLNGSIELAPLIGLADRIVDIVSTGQTLKENGLVETEHICDITS
RFIVNPVSYRMKDDVIDEMASRLSLVVEGETAK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagttactcacaatggcgatgccaaagggccggatatttgaagaagcggcaggg
ctgctgaggcaggcaggctacaggctccctgaggagtttgaagattcgagaaaactgatc
atcgatgtgccggaggaaaatcttcggtttatattagcgaagccgatggacgtaaccacg
tatgtggagcatggcgtggcagacgtcggaattgcgggcaaggatgtcatgctggaggag
gaacgcgatgtgtatgaggtactggatttaaacatcagcaaatgccacttagctgtcgcc
ggacttccgaatacagactggagcggagtagcgccaagaatcgcgacaaagtatccgaat
gtggcttccagttatttcagagagcagggagaacaagtcgagattattaagctcaacggt
tcaattgaactggctccgctcattgggcttgcagatcggatagtggacattgtttccaca
ggacagacgctgaaagaaaatgggcttgttgaaacggagcacatttgtgacattacctct
cgctttattgtcaacccggtaagctatcgcatgaaagacgatgtgattgacgaaatggca
tcccgcctatctctcgttgtggaaggagagacggcaaaatga

DBGET integrated database retrieval system