KEGG   Bacillus subtilis subsp. subtilis 168: BSU34930Help
Entry
BSU34930          CDS       T00010                                 

Gene name
hisZ
Definition
(RefSeq) ATP phosphoribosyltransferase regulatory subunit
  KO
K02502  ATP phosphoribosyltransferase regulatory subunit
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00340  Histidine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BSU34930 (hisZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His tRNA-synt_2b tRNA-synt_2d
Motif
Other DBs
NCBI-GeneID: 936602
NCBI-ProteinID: NP_391373
Pasteur: BG12606
BSORF: BG12606
UniProt: O34459
Position
complement(3588185..3589360)
Genome map
AA seq 391 aa AA seqDB search
MFMFEKPHGMRDTLPGLYETKKKVRRSLTDLIDKWGYQFMETPTLEFYDTVGVQSAIEEQ
QLFKLLDQDGKTLVLRPDMTGPIARVAASKLLKHGHPLRVGYAANVFRAQEREGGRPAEF
EQVGVELIGDGTTSADAEVIALVVGALKNAGLASFKIAIGHAGIADALFVEVLGNVERAD
VLRRFLYEKNYVGYREHVKSLPLSSIDKSRLLELLELRGGIEVCGRAEEIVDSAQGKSVV
DELKALWDILEDYGCTENVRLDLNMVSHMSYYTGILFEVYAENVGFVIGSGGRYNKLLGH
FDSPAPATGFGLRIDRLIEALHMKDEPCEIDAVIFSKEQRAQAIAYANEERMKGNKVVLQ
DLSGIENIDQMTKSFANVTYFIGARKEEQNG
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtttatgtttgaaaaaccgcacggcatgagagatacactgcccggtttatacgaaacg
aaaaaaaaggtgagacgatcgttaaccgatttgattgataaatggggatatcaatttatg
gaaacgccgacactggagttttacgataccgttggcgtccagtcagcaattgaagagcag
cagctgtttaagctacttgatcaggacggcaagacattggtgcttcgcccggatatgacg
gggccgattgcaagggtggcggcatcgaagcttctgaaacacggtcatccgctaagagtc
ggctatgcggcaaatgtattcagggctcaggagcgtgaaggcggacgtccggctgagttc
gagcaggtcggagtggagttaatcggtgacggcacgacgagcgcggatgcggaggtcatt
gctttagtcgtcggggcattaaaaaacgctgggctggcatcctttaaaattgcaattggc
catgccggcattgcggatgctttgtttgttgaggtgctcggaaacgttgaacgagctgat
gtgctgcggaggttcttatatgaaaagaactacgtcggctacagagagcatgtcaagtct
ctcccgctttcctccattgataaaagcaggctgcttgagctccttgaactgcggggcggt
atagaagtatgcggacgtgccgaggaaatcgtcgattctgcgcaaggaaaaagcgtggtt
gatgagctgaaggcgctgtgggacattcttgaggattacggatgtacggaaaatgtccgc
ctggatctgaatatggtcagccacatgagctattacacagggattttatttgaagtgtac
gccgagaatgtcggttttgtcattggaagcggcggccgttacaacaagctgctgggccat
tttgattcacctgcaccggcaacaggcttcgggcttcggatcgaccggctgattgaagcc
cttcatatgaaggacgaaccttgtgaaatagacgctgttattttcagcaaagagcagcgg
gcgcaagccatcgcttatgcgaatgaagaacgcatgaaagggaacaaagtggttcttcaa
gatttatcgggaatagaaaatatcgaccagatgacaaaatcttttgcaaacgtcacttat
tttatcggtgccagaaaggaagagcaaaatgggtaa

DBGET integrated database retrieval system