KEGG   Bacillus subtilis subsp. subtilis 168: BSU34940Help
Entry
BSU34940          CDS       T00010                                 

Gene name
yvpB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_C39_2 Peptidase_C39 Peptidase_C70 BtrH_N DUF3335
Motif
Other DBs
NCBI-GeneID: 936591
NCBI-ProteinID: NP_391374
Pasteur: BG14130
BSORF: BG14130
UniProt: O34735
Position
3589611..3590363
Genome map
AA seq 250 aa AA seqDB search
MKTLRTLCVLMILSGVIFFGLKIDAKDIDIPFLNSLKKVVSDSDTDSAANSKKELKGSAK
PLDVILYNQMDAPRLYNGCEVTSLAMVLNYAGYDVTKNTLANQVATVPLTYSSGLKGDPN
DGFVGDMANGPGLGVYHRPIYQLAKTYAGDKVSDLTGKSISAVYQQLEKGNPVWVITTAN
FTPVDNMQTWKTPNGTIEITYSEHSVAVTGYDDKYVYLNDPYGYKNRKTDRTSFEKAWKQ
MGSQAVVIQK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacactgcgaactctatgtgtcctgatgattctttcaggcgttatttttttcgga
cttaaaatagatgcaaaagatatagatattccttttttgaacagccttaaaaaagtggtt
tctgatagcgatacagactcagctgcgaatagcaaaaaggagctgaagggaagcgcaaaa
ccgctggatgtcatcctttacaatcaaatggacgcaccccggctctataacggctgtgaa
gtaacaagccttgcgatggtgctgaattatgcgggatacgacgtgacaaaaaataccctg
gcaaatcaggttgccacagtgcctttgacatacagcagcggattaaagggtgatccgaat
gacggatttgtcggggatatggcgaatggccctggtctcggtgtctaccatcgaccgatc
tatcagctggcgaaaacctatgcgggagacaaagtgtctgatctgactggaaaaagtatt
tccgctgtttatcagcagcttgaaaaaggcaatccagtttgggttattacgacagccaac
tttacgccagttgacaacatgcagacatggaaaacgccaaacggaacgatagaaattacg
tacagcgaacacagcgtcgccgttacgggatatgatgataaatatgtgtatctcaatgat
ccgtatggctataaaaacagaaaaaccgatagaacaagctttgaaaaagcgtggaaacaa
atgggcagccaggccgtggttattcaaaagtaa

DBGET integrated database retrieval system