KEGG   Bacillus subtilis subsp. subtilis 168: BSU34950Help
Entry
BSU34950          CDS       T00010                                 

Gene name
pelC
Definition
(RefSeq) pectate lyase C
  KO
K19551  pectate lyase C [EC:4.2.2.2 4.2.2.10]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU34950 (pelC)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.2  pectate lyase
     BSU34950 (pelC)
    4.2.2.10  pectin lyase
     BSU34950 (pelC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pectate_lyase Beta_helix DUF4957
Motif
Other DBs
NCBI-GeneID: 936594
NCBI-ProteinID: NP_391375
Pasteur: BG14129
BSORF: BG14129
UniProt: O34310
Position
3590603..3591268
Genome map
AA seq 221 aa AA seqDB search
MKKIVSILFMFGLVMGFSQFQPSTVFAADKVVHETIIVPKNTTYDGKGQRFVAGKELGDG
SQSENQDPVFRVEDGATLKNVVLGAPAADGVHTYGNVNIQNVKWEDVGEDALTVKKEGKV
TIDGGSAQKASDKIFQINKASTFTVKNFTADNGGKFIRQLGGSTFHVDVIIDKCTITNMK
EAIFRTDSKTSTVRMTNTRYSNVGQKWIGVQHIYENNNTQF
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaatcgtgtctatcctatttatgttcggtttggttatgggtttcagccagttt
cagccatcaaccgtttttgcagctgacaaagtggtgcacgaaacaattatcgtaccaaaa
aatacaacatatgacgggaaaggacagcggtttgtggcagggaaagaattaggtgacgga
agccagtcagaaaaccaagaccctgtttttcgtgtggaggatggagcaaccctgaaaaat
gtggtgcttggtgcacctgcagctgatggcgtgcacacttatggaaacgttaacattcag
aatgtgaaatgggaagatgttggtgaggatgcgttaacggtgaagaaggaaggaaaagtg
acgatcgacggcggttctgctcaaaaagcgtcagataagatattccaaatcaataaagcc
agtaccttcacagtgaaaaatttcacggcggataatggcgggaagttcattagacagctt
ggtggttcaaccttccacgttgatgtgatcatcgacaagtgcaccatcacaaacatgaag
gaagcgatattccggacggacagcaaaacaagcacggtcagaatgacaaatacacgctac
tctaatgtcggtcaaaaatggattggtgttcagcatatttacgaaaacaacaacactcaa
ttttaa

DBGET integrated database retrieval system