KEGG   Bacillus subtilis subsp. subtilis 168: BSU34960
Entry
BSU34960          CDS       T00010                                 

Symbol
yvoF
Name
(RefSeq) acetyltransferase YvoF
  KO
K24872  heptaprenylglycerol acetyltransferase [EC:2.3.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00564  Glycerophospholipid metabolism
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSU34960 (yvoF)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     BSU34960 (yvoF)
SSDB
Motif
Pfam: Hexapep Hexapep_2
Other DBs
NCBI-GeneID: 936620
NCBI-ProteinID: NP_391376
Pasteur: BG14128
BSORF: BG14128
UniProt: O34993 A0A6M3ZGR1
Position
complement(3591288..3591806)
AA seq 172 aa
MRKTDRHPVSGANSLWHVYQTVPFLKVVKNFIVIQIARYTPFIGMKNWLYRTFLRMKVGK
QTSFALMVMPDIMFPEKISVGTNTIIGYNTTILAHEYLIHEYRIGKVLIGDEVMIGANTT
ILPGVKIGDGAVVSAGTLVHKDVPDGAFVGGNPMRIIYTKEEMQERLKKSAE
NT seq 519 nt   +upstreamnt  +downstreamnt
gtgagaaaaacagatcgtcatccggtctcgggggccaactcactgtggcatgtctatcaa
acggtaccttttttaaaggtcgtcaaaaatttcattgtcattcaaattgcgagatatacg
ccgtttatagggatgaaaaactggctgtaccgcacatttctgcggatgaaggttggaaaa
cagacatcctttgccctcatggtgatgccagatatcatgtttccggaaaagatctcagtc
ggaacaaatacaatcatcgggtacaatacgaccattctggcccatgagtatttgattcac
gaataccggatcggcaaagttctgatcggggacgaagtgatgattggtgccaacacgacc
attctgcccggggtgaaaataggagatggcgcagttgtgtccgccggaacgcttgtccat
aaggatgtgcctgacggggcatttgtcggcggaaatccgatgaggatcatctatacgaag
gaagaaatgcaagaaagattgaaaaagtccgctgaataa

DBGET integrated database retrieval system