KEGG   Bacillus subtilis subsp. subtilis 168: BSU34960Help
Entry
BSU34960          CDS       T00010                                 

Gene name
yvoF
Definition
(RefSeq) acetyltransferase YvoF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2
Motif
Other DBs
NCBI-GeneID: 936620
NCBI-ProteinID: NP_391376
Pasteur: BG14128
BSORF: BG14128
UniProt: O34993
Position
complement(3591288..3591806)
Genome map
AA seq 172 aa AA seqDB search
MRKTDRHPVSGANSLWHVYQTVPFLKVVKNFIVIQIARYTPFIGMKNWLYRTFLRMKVGK
QTSFALMVMPDIMFPEKISVGTNTIIGYNTTILAHEYLIHEYRIGKVLIGDEVMIGANTT
ILPGVKIGDGAVVSAGTLVHKDVPDGAFVGGNPMRIIYTKEEMQERLKKSAE
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaaaacagatcgtcatccggtctcgggggccaactcactgtggcatgtctatcaa
acggtaccttttttaaaggtcgtcaaaaatttcattgtcattcaaattgcgagatatacg
ccgtttatagggatgaaaaactggctgtaccgcacatttctgcggatgaaggttggaaaa
cagacatcctttgccctcatggtgatgccagatatcatgtttccggaaaagatctcagtc
ggaacaaatacaatcatcgggtacaatacgaccattctggcccatgagtatttgattcac
gaataccggatcggcaaagttctgatcggggacgaagtgatgattggtgccaacacgacc
attctgcccggggtgaaaataggagatggcgcagttgtgtccgccggaacgcttgtccat
aaggatgtgcctgacggggcatttgtcggcggaaatccgatgaggatcatctatacgaag
gaagaaatgcaagaaagattgaaaaagtccgctgaataa

DBGET integrated database retrieval system