KEGG   Bacillus subtilis subsp. subtilis 168: BSU34970Help
Entry
BSU34970          CDS       T00010                                 

Gene name
hprP
Definition
(RefSeq) pyrophosphatase PpaX
  KO
K06019  pyrophosphatase PpaX [EC:3.6.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU34970 (hprP)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.1  inorganic diphosphatase
     BSU34970 (hprP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD DUF1320 Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 936613
NCBI-ProteinID: NP_391377
Pasteur: BG14127
BSORF: BG14127
UniProt: Q9JMQ2
Position
complement(3591810..3592460)
Genome map
AA seq 216 aa AA seqDB search
MSDKQVTTILFDLDGTLINTNELIIASFLHTLEHYYPSKYKREDVLAFIGPSLFDTFSSM
DPDKCEDMIAMYRAYNHDMHDSLVTEYETVYETLDALKKAGFTLGIVTTKLRDTVNMGLK
LTGIGEFFETVVTLDDVTNAKPDPEPVLLALKQLGSEPAEAIMVGDNYHDVLAGKNAGTK
TAGVAWTIKGPEMLAKHEPDFMLEKMSDLLQIVGVK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaaacaagtaacgacgattctgtttgatttagacggaacgcttattaatacg
aatgaattaattatcgcgtcctttttgcatacactggagcattattatccgagcaagtat
aaacgagaagatgtccttgcatttatcgggccgtctctttttgatacgttctcttcgatg
gaccctgataaatgcgaggatatgatcgctatgtacagagcgtacaatcatgacatgcat
gattcactcgtcactgaatatgaaacggtatatgagaccctggatgcattaaaaaaagcc
ggctttacattaggaattgtgacaacaaaattaagagatactgtcaatatgggcctcaag
ctcacgggaatcggcgaattctttgaaacagttgtcacccttgatgatgtgacgaatgca
aagcctgatcccgagcctgtgctgttagcgctgaaacagctaggaagcgagccggcggaa
gccattatggtcggtgataattaccatgatgtgctggcagggaaaaacgccggtacaaaa
acggcaggagtcgcatggacgattaaagggccggaaatgctggcgaagcatgagccggat
tttatgcttgagaaaatgagtgatctattacaaatcgttggagtgaagtaa

DBGET integrated database retrieval system