KEGG   Bacillus subtilis subsp. subtilis 168: BSU34980
Entry
BSU34980          CDS       T00010                                 

Symbol
yvoD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Gate
Other DBs
NCBI-GeneID: 936603
NCBI-ProteinID: NP_391378
Pasteur: BG14126
BSORF: BG14126
UniProt: O34382 A0A6M4JPI6
Position
complement(3592457..3593395)
AA seq 312 aa
MKKIFLAGLAAGFQTTWTLGKVIFPVTLLVTLLQHTPVMDWLVRLITPVMGLFGLSGEAA
IPLVLGNMLNLYAGIAGILTLDLSVKEVFILAVMLSFCHNLIIESTVAAKVGIRIGVILA
VRIGLAAVSAIVINLIWHGGKETAQYGFIAAKSAAPDSWLGMLAEALTKAGLGVLQLAAI
VIPLMIIIQFLRDLGWLYRFSRWLSPFTQLLGMNKNTSMTMVTGLTIGLAYGAGVMIKAV
EDDGVSKRDMTLAFIFLVACHAVVEDTLVFIPLGIPVWPLLLIRVTTAVLLTMAIAHTWK
KWKPSAVGKEAI
NT seq 939 nt   +upstreamnt  +downstreamnt
atgaagaagatctttctggccggtcttgcagcaggttttcaaacaacatggacgctgggt
aaagtgattttcccggtaacgctattggtcactttgctccagcatacccctgtcatggat
tggcttgtacggctgatcacaccggtaatgggtctcttcgggctttctggtgaagcggcc
attccgcttgtactgggaaatatgctgaatctgtatgcgggaattgccgggattttaaca
ttggatttatctgtgaaagaagtctttattttagctgttatgctttctttctgtcataac
ttgattatcgaatcgacagttgccgcaaaggttggtatcagaattggcgtcatattggcc
gtgcgcatcggtttggccgctgtgtcagccatcgtcatcaacctcatttggcatggcgga
aaggaaacggcgcagtacggttttatcgctgcgaagagcgcggcgccagacagctggcta
ggaatgttggcagaagcattaacgaaagccggacttggtgttttgcagctggcggcaata
gtgatcccgctgatgattatcatccagtttttaagagatttaggctggctttatcggttt
tccaggtggctgtcgccgtttacgcagctgcttggcatgaataaaaatacgtctatgacg
atggtgacgggactgacgattggtctggcctacggagcgggtgtcatgatcaaagctgtc
gaggatgacggcgtgagcaagcgggacatgacattggcatttatatttctcgttgcctgc
cacgcggtcgtggaagatacacttgtctttattccgcttggcataccggtctggccgctt
cttttgattcgtgtcaccacagcagttctgctgacaatggctattgcgcacacgtggaaa
aaatggaaaccctcagcggttggaaaggaagcaatatga

DBGET integrated database retrieval system