KEGG   Bacillus subtilis subsp. subtilis 168: BSU34990Help
Entry
BSU34990          CDS       T00010                                 

Gene name
lgt
Definition
(RefSeq) prolipoprotein diacylglyceryl transferase
  KO
K13292  phosphatidylglycerol---prolipoprotein diacylglyceryl transferase [EC:2.5.1.145]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU34990 (lgt)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.145  phosphatidylglycerol---prolipoprotein diacylglyceryl transferase
     BSU34990 (lgt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LGT
Motif
Other DBs
NCBI-GeneID: 936609
NCBI-ProteinID: NP_391379
Pasteur: BG12611
BSORF: BG12611
UniProt: O34752
Position
complement(3593419..3594228)
Genome map
AA seq 269 aa AA seqDB search
MNEAIEPLNPIAFQLGPLAVHWYGIIIGLGALLGLWIAMRESEKRGLQKDTFIDLVLFAI
PIAIICARIYYVAFEWDYYAAHPGEIIKIWKGGIAIHGGLIGAILTGYVFSRVKNLSFWK
LADIAAPSILLGQAIGRWGNFMNQEAHGEAVSRAFLENLHLPEFIINQMYINGQYYHPTF
LYESLWSFVGVIVLLLLRRANLRRGEMFLIYIIWYSIGRYFIEGMRTDSLMLTDSLRIAQ
VISIVLIVLAVAAIIFRRVKGYSKERYAE
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagcgatagaaccactcaatccgatagcatttcagctggggccgttagccgtc
cactggtacggaatcattatcggtctcggcgctttgctcgggctgtggatagcgatgagg
gaaagtgaaaaacgggggctgcagaaagatacgtttattgatcttgtcctgtttgccatt
ccaattgcgattatttgcgcacgaatttattatgttgcctttgaatgggactattatgcg
gcacatccgggagaaatcattaagatttggaagggcggcattgccattcatggcggatta
atcggcgccattttaacgggttatgtgttttcgagagtgaaaaacctttcgttctggaag
cttgcggatattgccgcgcccagcattttgctcggccaggcgatcggccgctgggggaac
ttcatgaatcaggaagcgcacggcgaggctgtcagcagagcctttttagaaaacctgcac
ctgcctgaatttatcatcaatcaaatgtatatcaatgggcaatattatcatcctactttt
ttatatgaatcactatggagctttgtcggcgtcattgttttactgctgctgcgcagagcg
aatttgcgtagaggcgagatgttcttgatctatatcatttggtattcaatcggaagatac
tttattgaaggaatgcggactgacagcttaatgctgactgattcacttcgcatcgctcag
gtgatttcaatcgtattgattgttttggctgtggcagccatcatcttcagacgcgtcaag
ggatactcgaaggagcggtacgcggagtag

DBGET integrated database retrieval system