KEGG   Bacillus subtilis subsp. subtilis 168: BSU35000Help
Entry
BSU35000          CDS       T00010                                 

Gene name
hprK
Definition
(RefSeq) HPr kinase/phosphorylase
  KO
K06023  HPr kinase/phosphorylase [EC:2.7.11.- 2.7.4.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU35000 (hprK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.-  
     BSU35000 (hprK)
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-  
     BSU35000 (hprK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hpr_kinase_C Hpr_kinase_N DRTGG AAA_18 PucR AAA_29 AAA_16 AAA_28
Motif
Other DBs
NCBI-GeneID: 936615
NCBI-ProteinID: NP_391380
Pasteur: BG14125
BSORF: BG14125
UniProt: O34483
Position
complement(3594242..3595174)
Genome map
AA seq 310 aa AA seqDB search
MAKVRTKDVMEQFNLELISGEEGINRPITMSDLSRPGIEIAGYFTYYPRERVQLLGKTEL
SFFEQLPEEEKKQRMDSLCTDVTPAIILSRDMPIPQELIDASEKNGVPVLRSPLKTTRLS
SRLTNFLESRLAPTTAIHGVLVDIYGVGVLITGKSGVGKSETALELVKRGHRLVADDCVE
IRQEDQDTLVGNAPELIEHLLEIRGLGIINVMTLFGAGAVRSNKRITIVMNLELWEQGKQ
YDRLGLEEETMKIIDTEITKLTIPVRPGRNLAVIIEVAAMNFRLKRMGLNAAEQFTNKLA
DVIEDGEQEE
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggttcgcacaaaagacgtaatggaacagttcaatttggaattaatcagcgga
gaagaaggaattaaccgcccgattacaatgagtgacctatcaagaccaggtattgaaatt
gccggatattttacatattacccgagggagcgcgtgcagcttctcggaaaaacagagctt
tctttctttgaacagcttcctgaagaggagaaaaagcagcgaatggattctctgtgcact
gatgtaacaccagctattattctttctagagatatgcccatcccgcaggagctgattgac
gcctccgagaaaaatggggtgcctgtcctcagatcgccgctgaaaacgacaagactgtca
agccgtttaaccaacttccttgagagcaggctggcgcctaccacagcaattcatggcgtt
cttgtcgatatatatggtgtcggcgtgctgatcacaggaaaaagcggcgtcggaaaaagc
gaaacagcgctagagcttgtgaaaagagggcatcgccttgttgccgatgattgcgttgaa
atacggcaggaggatcaggatactcttgtgggaaacgctccggaattaattgagcacctt
cttgagatcaggggccttggcattatcaatgtgatgacgctatttggcgctggcgcggtc
agaagcaataaacgaatcacgattgtcatgaatcttgaactctgggagcagggcaagcaa
tacgaccggctcggacttgaggaagagaccatgaaaatcattgatacagaaattacaaaa
ctgacgattcccgtccgcccaggccgaaatcttgcagtcatcatcgaagtggcagcaatg
aacttcagattgaagcggatggggctgaatgccgctgaacaatttaccaacaagctggcg
gacgtcattgaagacggtgaacaagaagaatag

DBGET integrated database retrieval system