KEGG   Bacillus subtilis subsp. subtilis 168: BSU35020Help
Entry
BSU35020          CDS       T00010                                 

Gene name
nagBA
Definition
(RefSeq) glucosamine-6-phosphate deaminase 1
  KO
K02564  glucosamine-6-phosphate deaminase [EC:3.5.99.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BSU35020 (nagBA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.6  glucosamine-6-phosphate deaminase
     BSU35020 (nagBA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucosamine_iso Pribosyltran
Motif
Other DBs
NCBI-GeneID: 936619
NCBI-ProteinID: NP_391382
Pasteur: BG12631
BSORF: BG12631
UniProt: O35000
Structure
PDB: 

Position
3596543..3597271
Genome map
AA seq 242 aa AA seqDB search
MKVMECQTYEELSQIAARITADTIKEKPDAVLGLATGGTPEGTYRQLIRLHQTENLSFQN
ITTVNLDEYAGLSSDDPNSYHFYMNDRFFQHIDSKPSRHFIPNGNADDLEAECRRYEQLV
DSLGDTDIQLLGIGRNGHIGFNEPGTSFKSRTHVVTLNEQTRQANARYFPSIDSVPKKAL
TMGIQTILSSKRILLLISGKSKAEAVRKLLEGNISEDFPASALHLHSDVTVLIDREAASL
RP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaatggaatgtcaaacgtatgaagagctaagccaaatagcagccagaataacg
gcagatacaatcaaagaaaaacctgatgctgttctcggtttagcgacgggcggcacaccg
gaaggcacgtatcgccagctgatccgcctgcaccaaactgagaatctctcatttcaaaac
atcactacagttaatttggatgagtacgccggactttcaagcgatgacccgaacagctat
cacttctatatgaacgaccgtttttttcagcatatcgacagcaagcctagccggcatttt
attccgaatggaaatgcagacgatttggaggccgaatgcagacggtatgaacagctagtc
gattccctcggcgacactgacattcagcttctcggcatcggccgaaacggacacatcggc
tttaacgaaccgggaacgtctttcaagtcgcgaactcatgttgtgacattaaatgagcaa
acccgccaagcgaatgccagatattttccctccatagacagcgtgccgaaaaaagcactg
acaatgggaattcaaacgatactctcaagcaagcgcattctgctgcttatttctggaaaa
agcaaagcggaagctgttcgtaagctgttagaaggaaacataagcgaagattttcccgca
tctgctttgcacctgcattccgatgttacggttttgattgatcgtgaagccgcgtcatta
agaccttga

DBGET integrated database retrieval system