KEGG   Bacillus subtilis subsp. subtilis 168: BSU35030
Entry
BSU35030          CDS       T00010                                 

Symbol
yvoA
Name
(RefSeq) HTH-type transcriptional repressor YvoA
  KO
K24967  GntR family transcriptional regulator, N-acetylglucosamine utilization regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU35030 (yvoA)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   GntR family
    BSU35030 (yvoA)
SSDB
Motif
Pfam: UTRA GntR HTH_DeoR AbiEi_4 HTH_23 HTH_41 HTH_Crp_2 HTH_24 PaaX HTH_11 TrmB HTH_28 Sigma70_r4 RP-C DUF190 HTH_IclR Rrf2 RepL HTH_10 MarR_2 Sigma70_r4_2
Other DBs
NCBI-GeneID: 936626
NCBI-ProteinID: NP_391383
Pasteur: BG14124
BSORF: BG14124
UniProt: O34817 A0A6M4JPJ8
Structure
PDB: 
4U0Y 4U0W 4U0V 2WV0 4WWC

Position
3597289..3598020
AA seq 243 aa
MNINKQSPIPIYYQIMEQLKTQIKNGELQPDMPLPSEREYAEQFGISRMTVRQALSNLVN
EGLLYRLKGRGTFVSKPKMEQALQGLTSFTEDMKSRGMTPGSRLIDYQLIDSTEELAAIL
GCGHPSSIHKITRVRLANDIPMAIESSHIPFELAGELNESHFQSSIYDHIERYNSIPISR
AKQELEPSAATTEEANILGIQKGAPVLLIKRTTYLQNGTAFEHAKSVYRGDRYTFVHYMD
RLS
NT seq 732 nt   +upstreamnt  +downstreamnt
atgaatatcaataaacaatcgcctattccgatttactatcagattatggagcaattaaaa
acccaaattaagaacggagagctgcagccggatatgcctcttccttctgagcgcgaatat
gccgaacaattcgggatcagccggatgacagttcgccaggcgctttctaatttagttaat
gaaggcttgctctatcgcctgaaagggcggggcacctttgtcagcaagccaaaaatggaa
caagcacttcaagggctgacaagctttaccgaggatatgaaaagccgcgggatgacaccg
ggcagcaggctcattgattatcagcttattgattcaactgaggagctcgcggctatatta
ggctgcgggcacccctcctctatccataaaatcactcgggtgcggctggcaaatgatatt
ccgatggcgattgagtcctcacatattccgtttgagcttgcgggtgaattgaacgaatcg
cattttcagtcgtcgatctatgatcatattgaaaggtacaacagcataccgatttcccgt
gcaaaacaggagcttgagccaagcgctgccaccacggaagaagcgaatattcttggtatt
caaaagggagcgcctgtcctattaattaaacgaacaacatatctgcagaacggaactgct
tttgagcatgcaaaatccgtatacagaggcgaccgttatacatttgtccactatatggat
cgtctttcataa

DBGET integrated database retrieval system