KEGG   Bacillus subtilis subsp. subtilis 168: BSU35030Help
Entry
BSU35030          CDS       T00010                                 

Gene name
yvoA
Definition
(RefSeq) HTH-type transcriptional repressor YvoA
  KO
K03710  GntR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU35030 (yvoA)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Helix-turn-helix
   GntR family
    BSU35030 (yvoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UTRA GntR HTH_DeoR AbiEi_4 HTH_24 HTH_Crp_2 HTH_23 HTH_28 PaaX HTH_11 TrmB Sigma70_r4 HTH_41 HTH_IclR RP-C Rrf2 DUF190 HTH_10 Sigma70_r4_2
Motif
Other DBs
NCBI-GeneID: 936626
NCBI-ProteinID: NP_391383
Pasteur: BG14124
BSORF: BG14124
UniProt: O34817
Structure
PDB: 

Position
3597289..3598020
Genome map
AA seq 243 aa AA seqDB search
MNINKQSPIPIYYQIMEQLKTQIKNGELQPDMPLPSEREYAEQFGISRMTVRQALSNLVN
EGLLYRLKGRGTFVSKPKMEQALQGLTSFTEDMKSRGMTPGSRLIDYQLIDSTEELAAIL
GCGHPSSIHKITRVRLANDIPMAIESSHIPFELAGELNESHFQSSIYDHIERYNSIPISR
AKQELEPSAATTEEANILGIQKGAPVLLIKRTTYLQNGTAFEHAKSVYRGDRYTFVHYMD
RLS
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcaataaacaatcgcctattccgatttactatcagattatggagcaattaaaa
acccaaattaagaacggagagctgcagccggatatgcctcttccttctgagcgcgaatat
gccgaacaattcgggatcagccggatgacagttcgccaggcgctttctaatttagttaat
gaaggcttgctctatcgcctgaaagggcggggcacctttgtcagcaagccaaaaatggaa
caagcacttcaagggctgacaagctttaccgaggatatgaaaagccgcgggatgacaccg
ggcagcaggctcattgattatcagcttattgattcaactgaggagctcgcggctatatta
ggctgcgggcacccctcctctatccataaaatcactcgggtgcggctggcaaatgatatt
ccgatggcgattgagtcctcacatattccgtttgagcttgcgggtgaattgaacgaatcg
cattttcagtcgtcgatctatgatcatattgaaaggtacaacagcataccgatttcccgt
gcaaaacaggagcttgagccaagcgctgccaccacggaagaagcgaatattcttggtatt
caaaagggagcgcctgtcctattaattaaacgaacaacatatctgcagaacggaactgct
tttgagcatgcaaaatccgtatacagaggcgaccgttatacatttgtccactatatggat
cgtctttcataa

DBGET integrated database retrieval system