KEGG   Bacillus subtilis subsp. subtilis 168: BSU35040Help
Entry
BSU35040          CDS       T00010                                 

Gene name
yvnB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos LTD
Motif
Other DBs
NCBI-GeneID: 936623
NCBI-ProteinID: NP_391384
Pasteur: BG14123
BSORF: BG14123
UniProt: O34986
Position
complement(3598040..3601909)
Genome map
AA seq 1289 aa AA seqDB search
MRKYTVIASILLSFLSVLSGGHHESKAFPVVQQELFQTPHYIPLLENPPQIDVKAEMRSN
LMIEAQVRDNSYQAFSAFLFYKQSNELGYKMVPMDPTPGAVRKFLAQIPKRLIWNSELEY
YIVMSNGKQRVESETKKLKLEGYQADLAHIPELLITELAVDTKNIGRADGYEFIEIFNTT
DRTIDFKDYHIRYRYPKEGPDSDLIWRPDERILIPSGETFVVWLKPAGHPELTSADFNRY
YQTQLKEGKNLAVIDETEGMANTRPRAVVISTNTGKDISVAHYRKHALRRLSSVLYKYPL
NGTAELLNISIGEKNPSPGTVLQAQVPDQKRKIKLDKEKPVIEDLTDRKPVRPAESIELR
ADIRDRSLVKTVAFYYRTDENKPFKRILAEKDRNDNLFHYIVYSPELIGKDQLEYYVAAG
DGINEARTPVKMIDIKQTSKAHGLRMNIENRDTLSGTQFLKATTEGRADSIKLWIDGKKQ
VTEPAMEKEVYFAFDTRKTNLYFKNAVTMEGKVLKVFDDTTNKYRTYSVPLPETLLRKGK
QLQRITIRSGSKVSPFDTAENRDDFLVKNARLVLSDGTVIRDQRVSPEKELFIGDNQRSN
KSWQFQFNLPDGLFTSQLLEWDTSKLSEGAHHIQASDGKENVSLVVRVDNSGPHIEPNIT
EGQTYKGNLILQADMYDKWSRIEEAEASLDGESITLPYHTSSSDLLPGKHSLKVTATDLA
GNKTVIERIFKTEREHPDQPEVIDSEADTHKAKLSVRVKDPTNDAMDVGFYRGFQYTARN
HVKIFKHASLTEPPKSFVPERETPFTNKELERVSAADGKTVSTENKELFPYHRFEVTVDP
SIDENDLAESVWKGSSLPGRKVTMYAWNYRTNEWQPVDSFVAKDDKPFTLKASVIAADFV
RESKMNVIVQDEIPPAKDMYTFVWMSDTQYYAESYPHIFDKQTEWIKDNQKQLNIKYVFH
TGDIVDDSADIRQWKNADRSMSVLDKSGIPYGVLAGNHDVGHKDGSYRAFGKYFGSDRFD
KKFHYGGSYKNNRGHYDLISSNGNDYIMLYMGWGITDEDIAWMNQVLKKHPDRMAILAFH
EYLLVSGNRSPIGEKIFKEIVKPNPNVVMVLSGHYHSAMRKTDELDDDGDGKPDRLVHQM
LADYQGGPEGGQGYLRLLQFDQANDMVHVSTYSPYVKDKNYYDTDTYGNKDEFSLSLDLK
PRIKKVETDYFECNVYTNEELGKREQVKSGDTAEFRWDHLEPQSVYYWYIIVEDSFNGKT
KSPIWKFKTKKETYRPAPDQFDFRHVSNP
NT seq 3870 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaatacacggttattgcttctatattactgtcttttctttccgttttgtctggc
ggccatcatgaatcgaaagcttttcctgttgtacagcaggaactatttcaaacgcctcat
tacatacccttgcttgaaaatcctcctcaaattgatgtgaaagctgaaatgagaagcaat
ctaatgattgaggctcaagttcgcgataattcgtatcaagcattttccgcctttcttttt
tataaacaaagtaatgagctgggctacaaaatggtgccgatggacccgacccccggagcg
gtccgcaagtttttggcacaaattccgaaacgtttgatttggaacagcgagcttgagtat
tacattgtgatgtcgaatgggaagcagcgggttgagtcggagacgaagaaactgaagctt
gaaggataccaggctgaccttgcccatattccggagcttctgatcacagagctggcggtt
gatacgaagaatataggacgcgcagacggttatgaatttattgagatttttaatacgact
gacagaacgattgattttaaagactaccatatccgttaccgctacccaaaagaagggcct
gactccgatctgatttggagacctgatgaaaggatcttgataccatccggcgaaacgttt
gtcgtctggctgaagcctgccgggcatccagaattgacgtcagcggatttcaatcgttat
tatcagacacaactaaaagaaggaaaaaatcttgcggtgatagacgagacagagggtatg
gccaatacgaggccgcgggccgttgtgatatcaacgaatacaggaaaggacatttcggtt
gcgcattatcggaaacatgcgctgcgccggctgtcatcagtgctttataagtatccactg
aacggaacagcagaacttctgaacatttcaatcggggaaaagaatccgtctcccggaacc
gtattacaggcacaggtgcccgaccagaaacggaaaatcaagctcgataaagaaaagccg
gtcattgaggatttgactgaccgcaagcctgtccgccctgctgaaagcattgagctgcgg
gctgacatacgggaccgaagcctagtgaaaacagtggccttttactaccggacggatgag
aacaaaccgtttaagcgaattcttgctgaaaaagaccgcaacgataatctcttccattat
attgtgtattcgcctgaattgatcgggaaggatcagctagagtattatgtggcggccggg
gacgggatcaatgaagcgagaacgccggtcaaaatgattgatattaaacaaacaagcaag
gcgcacggtctgcggatgaatattgaaaacagagacacgctgtcgggaactcaatttctc
aaagccacgacagaagggcgagctgacagcattaagctatggattgacgggaaaaaacaa
gtgacagagcccgcgatggaaaaagaagtatattttgcattcgatacgaggaaaacgaac
ctttattttaaaaacgcggtaacgatggaaggcaaagtgctgaaggtgttcgatgataca
acaaataaataccgcacctattctgttccattgccagagacactgcttcggaaagggaag
cagctgcagcgtattacgatacgttcaggttcgaaggtgtctccgtttgatacggctgaa
aaccgtgatgacttcttagtcaaaaacgcccgattggtgttatcggatggaacggtgatc
agagatcagagggtgtctcctgagaaggaactctttattggcgataatcagcgctcgaat
aaaagctggcaatttcagttcaatctgcctgacggactatttacatcacagctgctggag
tgggatacatcaaagctttctgaaggcgctcaccatattcaagcaagcgacgggaaggaa
aatgtcagcctggttgtacgggtagataattcaggacctcacattgagccgaatatcacc
gaggggcaaacgtataaaggaaaccttatcctgcaggcggatatgtatgataaatggagc
agaattgaggaagcggaggcgtcgttagatggagaaagcattacactcccatatcatacg
tcatcttctgaccttttgccgggaaaacattctctaaaagtgacagcaacggatctcgcg
ggcaataaaacagtgattgagaggatatttaaaaccgaacgagagcatccggaccagccg
gaggttatagacagcgaagccgacacgcataaggccaagctttctgtacgggtgaaagat
ccgacgaatgatgccatggatgttggtttttataggggatttcaatatacagcgcgcaat
catgtgaaaatatttaagcacgcgtcactgactgaaccgccgaaaagctttgtgccggaa
agggagaccccatttacgaataaagaattggagcgggtatcagctgctgatggaaaaaca
gtatcgacagaaaacaaagagcttttcccttatcatcgctttgaagtgacggttgatcca
tcaattgatgagaatgatctggcagaatcagtctggaagggcagttctttgccggggaga
aaggtgacgatgtatgcttggaattatcggacaaacgaatggcagcctgttgacagcttc
gtcgcgaaggatgacaaaccgtttacgctgaaagcgtctgtgattgccgccgattttgta
cgggagtcgaaaatgaatgtgattgtacaggatgaaattcctcctgcgaaggatatgtac
acatttgtctggatgtctgatacacagtattacgccgaaagctatccgcatatttttgat
aaacagaccgaatggataaaagataatcaaaagcagctcaatatcaaatatgtgttccac
acgggtgatattgtagatgattccgccgatatcagacagtggaaaaacgctgatcggtca
atgtccgttctggataagagcggaattccttacggcgtgctggccggcaatcacgatgtc
ggacataaggacggctcctacagggcgtttggcaaatattttggcagcgatcgttttgat
aaaaaatttcattatggcggttcctataaaaataaccgcggacattatgacctgatttct
agcaacggcaatgattatatcatgctgtacatgggatggggcattacggatgaagacatc
gcgtggatgaatcaggtgctgaagaagcatcctgaccggatggccattttagcttttcat
gagtatttgctggtcagcggaaacagaagcccaatcggagagaaaatattcaaagaaatc
gtaaagccgaacccgaatgtcgtgatggtgttgagcgggcattatcatagtgcgatgaga
aaaacagatgagctggatgatgatggtgatgggaaaccggatcgtcttgtgcatcaaatg
ctggccgattatcagggcgggccagaaggcggccaagggtatttgcgtttgcttcaattt
gaccaagccaatgacatggtgcacgtatcgacgtactctccgtatgtaaaggataagaac
tactatgatacggatacctatggcaacaaggatgaattttccctttcgcttgatttgaag
ccaagaatcaaaaaggtggaaaccgattattttgaatgtaacgtatataccaatgaagag
ctcggaaaacgggagcaagtgaagagcggggacacagctgaattccgctgggatcatctt
gaaccgcagtctgtttattattggtacattatagtggaagacagttttaacggcaaaacg
aaatcaccgatctggaagttcaagacgaaaaaagaaacatatcgtccggcaccagaccag
tttgattttcgccatgtctccaatccttaa

DBGET integrated database retrieval system