KEGG   Bacillus subtilis subsp. subtilis 168: BSU35050Help
Entry
BSU35050          CDS       T00010                                 

Gene name
yvnA
Definition
(RefSeq) HTH-type transcriptional regulator YvnA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR HTH_34 HTH_27 MarR_2 HTH_11 DMAP1_like HxlR Phage_rep_O DUF4423 Fe_dep_repress PadR CvfB_WH HTH_Crp_2 HTH_24 HTH_1 Rrf2 HTH_20 HTH_Tnp_4
Motif
Other DBs
NCBI-GeneID: 936639
NCBI-ProteinID: NP_391385
Pasteur: BG14122
BSORF: BG14122
UniProt: O34692
Position
3602074..3602547
Genome map
AA seq 157 aa AA seqDB search
MDNSIHDELFQAIQQFALKRDKRVWQKVQIPSIGISSQHHDHLKKDWTLTQLHIVSCIHT
SQNVNNSFLASRLHISKAAVSKAVHALLKHNIITVTKKPGNKKEIFYTLTDSGRKLAALH
EQLHEKAKEQYKQLFNEFSIDDLKTVTAFFNLWIKYM
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggacaacagcattcatgatgaattatttcaagctatacaacaattcgcattaaaaagg
gataaacgcgtctggcaaaaggtgcagataccatccattggcatatcctcacaacatcac
gatcacctcaaaaaagactggactttgacccagcttcacattgtttcctgcatacatacc
agccaaaatgtgaacaacagcttcttagcatcccgtttacacatctcaaaagccgctgtt
tcaaaagcggttcatgctttgttgaaacacaatatcattacagtgacaaaaaagcctggc
aacaaaaaagaaattttttatacgctaactgatagcggcagaaaattggcggcattacat
gaacagcttcatgagaaagcaaaggagcaatataaacagcttttcaatgaattttcaatt
gatgatttaaaaacagtgactgcgtttttcaacttgtggatcaaatatatgtaa

DBGET integrated database retrieval system