KEGG   Bacillus subtilis subsp. subtilis 168: BSU35050
Entry
BSU35050          CDS       T00010                                 

Symbol
yvnA
Name
(RefSeq) HTH-type transcriptional regulator YvnA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MarR HTH_34 HTH_27 MarR_2 HTH_11 DMAP1_like HxlR Phage_rep_O MC2 DUF4423 Rrf2 Fe_dep_repress PadR CvfB_WH HTH_24 HTH_1 HTH_Tnp_4 HTH_Crp_2
Other DBs
NCBI-GeneID: 936639
NCBI-ProteinID: NP_391385
Pasteur: BG14122
BSORF: BG14122
UniProt: O34692 A0A6M4JPJ6
Position
3602074..3602547
AA seq 157 aa
MDNSIHDELFQAIQQFALKRDKRVWQKVQIPSIGISSQHHDHLKKDWTLTQLHIVSCIHT
SQNVNNSFLASRLHISKAAVSKAVHALLKHNIITVTKKPGNKKEIFYTLTDSGRKLAALH
EQLHEKAKEQYKQLFNEFSIDDLKTVTAFFNLWIKYM
NT seq 474 nt   +upstreamnt  +downstreamnt
atggacaacagcattcatgatgaattatttcaagctatacaacaattcgcattaaaaagg
gataaacgcgtctggcaaaaggtgcagataccatccattggcatatcctcacaacatcac
gatcacctcaaaaaagactggactttgacccagcttcacattgtttcctgcatacatacc
agccaaaatgtgaacaacagcttcttagcatcccgtttacacatctcaaaagccgctgtt
tcaaaagcggttcatgctttgttgaaacacaatatcattacagtgacaaaaaagcctggc
aacaaaaaagaaattttttatacgctaactgatagcggcagaaaattggcggcattacat
gaacagcttcatgagaaagcaaaggagcaatataaacagcttttcaatgaattttcaatt
gatgatttaaaaacagtgactgcgtttttcaacttgtggatcaaatatatgtaa

DBGET integrated database retrieval system