KEGG   Bacillus subtilis subsp. subtilis 168: BSU35060Help
Entry
BSU35060          CDS       T00010                                 

Gene name
cypX
Definition
(RefSeq) cytochrome P450 CypX
  KO
K17474  pulcherriminic acid synthase [EC:1.14.15.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bsu00199]
    BSU35060 (cypX)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.13  pulcherriminic acid synthase
     BSU35060 (cypX)
Cytochrome P450 [BR:bsu00199]
 Cytochrome P450, bacteria type
  CYP134 family
   BSU35060 (cypX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 936624
NCBI-ProteinID: NP_391386
Pasteur: BG12580
BSORF: BG12580
UniProt: O34926
Structure
PDB: 

Position
complement(3602588..3603805)
Genome map
AA seq 405 aa AA seqDB search
MSQSIKLFSVLSDQFQNNPYAYFSQLREEDPVHYEESIDSYFISRYHDVRYILQHPDIFT
TKSLVERAEPVMRGPVLAQMHGKEHSAKRRIVVRSFIGDALDHLSPLIKQNAENLLAPYL
ERGKSDLVNDFGKTFAVCVTMDMLGLDKRDHEKISEWHSGVADFITSISQSPEARAHSLW
CSEQLSQYLMPVIKERRVNPGSDLISILCTSEYEGMALSDKDILALILNVLLAATEPADK
TLALMIYHLLNNPEQMNDVLADRSLVPRAIAETLRYKPPVQLIPRQLSQDTVVGGMEIKK
DTIVFCMIGAANRDPEAFEQPDVFNIHREDLGIKSAFSGAARHLAFGSGIHNCVGAAFAK
NEIEIVANIVLDKMRNIRLEEDFCYAESGLYTRGPVSLLVAFDGA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagccaatcgattaaattgtttagtgtgctttctgatcaatttcaaaacaatccatat
gcttatttttcacaactgcgggaggaagatccggttcattatgaagagtcgatagacagt
tattttatcagccgctatcatgatgtccgctatatccttcagcatccggatatcttcacg
acgaaatcacttgttgagcgtgccgaaccagtcatgcgaggccctgtgctggcccaaatg
catggaaaagaacactctgccaaaagaagaattgtagtgagaagctttatcggtgacgca
ctggatcatctgtctccattgattaaacaaaatgcagaaaacttgttagcgccttatctt
gaaagagggaaaagtgatctcgtcaatgattttggaaagacgtttgcggtgtgcgtcacg
atggacatgctcgggctggataaaagagaccatgaaaaaatctctgagtggcacagcgga
gttgccgattttatcacgagtatctctcaatctcctgaagcgcgggcacattcgttatgg
tgcagcgaacagctttcccaatacttgatgccggtcattaaagaacgtcgcgtcaatccg
ggatcagatttaatttcgatcctatgtacttctgaatatgaaggcatggcgctgtcggac
aaggatatactcgcactgattcttaatgtgctgttagccgcaacggaaccggctgataag
acgctggcactgatgatctaccatttgctcaacaatcctgagcagatgaatgatgttttg
gctgaccgttcgttagttccgagagccattgcggagacattgcgttataaaccgccggtt
cagctgattccgcggcagctgtcccaagatacagtggtcggcggtatggaaatcaaaaaa
gatacgattgttttttgtatgatcggtgcggctaaccgggaccctgaagcatttgaacag
cctgacgtgtttaatattcatcgggaagatcttggtatcaagagcgcttttagcggcgcc
gcccggcatctcgctttcggatccggcattcataactgtgtaggagcagcttttgccaaa
aacgaaatcgaaattgtagctaatattgtgctggataagatgcggaatatcagattagag
gaagatttttgttatgctgagtccggtctgtatacacgcggacctgtttcacttctcgtt
gcgtttgacggggcataa

DBGET integrated database retrieval system