KEGG   Bacillus subtilis subsp. subtilis 168: BSU35070Help
Entry
BSU35070          CDS       T00010                                 

Gene name
yvmC
Definition
(RefSeq) hypothetical protein
  KO
K17485  cyclo(L-leucyl-L-leucyl) synthase [EC:2.3.2.22]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU35070 (yvmC)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.22  cyclo(L-leucyl-L-leucyl) synthase
     BSU35070 (yvmC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDPS
Motif
Other DBs
NCBI-GeneID: 936633
NCBI-ProteinID: NP_391387
Pasteur: BG14121
BSORF: BG14121
UniProt: O34351
Position
complement(3603821..3604567)
Genome map
AA seq 248 aa AA seqDB search
MTGMVTERRSVHFIAEALTENCREIFERRRHVLVGISPFNSRFSEDYIYRLIGWAKAQFK
SVSVLLAGHEAANLLEALGTPRGKAERKVRKEVSRNRRFAERALVAHGGDPKAIHTFSDF
IDNKAYQLLRQEVEHAFFEQPHFRHACLDMSREAIIGRARGVSLMMEEVSEDMLNLAVEY
VIAELPFFIGAPDILEVEETLLAYHRPWKLGEKISNHEFSICMRPNQGYLIVQEMAQMLS
EKRITSEG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaatggtaacggaaagaaggtctgtgcattttattgctgaggcattaacagaa
aactgcagagaaatatttgaacggcgcaggcatgttttggtggggatcagcccatttaac
agcaggttttcagaggattatatttacagattaattggatgggcgaaagctcaatttaaa
agcgtttcagttttacttgcagggcatgaggcggctaatcttctagaagcgcttggaact
ccgagaggaaaggctgaacgaaaagtaaggaaagaggtatcacgaaacaggagatttgca
gaaagagcccttgtggctcatggcggggatccgaaggcgattcatacattttctgatttt
atagataacaaagcctaccagctgttgagacaagaagttgaacatgcattttttgagcag
cctcattttcgacatgcttgtttggacatgtctcgtgaagcgataatcgggcgtgcgcgg
ggcgtcagtttgatgatggaagaagtcagtgaggatatgctgaatttggctgtggaatat
gtcatagctgagctgccgttttttatcggagctccggatattttagaggtggaagagaca
ctccttgcttatcatcgtccgtggaagctgggtgagaagatcagtaaccatgaattttct
atttgtatgcggccgaatcaagggtatctcattgtacaggaaatggcgcagatgctttct
gagaaacggatcacatctgaaggatga

DBGET integrated database retrieval system