KEGG   Bacillus subtilis subsp. subtilis 168: BSU35080Help
Entry
BSU35080          CDS       T00010                                 

Gene name
yvmB
Definition
(RefSeq) HTH-type transcriptional regulator YvmB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR HTH_24 HTH_45 MarR_2 HTH_34 HTH_27 Rrf2 Flagellin_N Fe_dep_repress PadR
Motif
Other DBs
NCBI-GeneID: 936625
NCBI-ProteinID: NP_391388
Pasteur: BG11018
BSORF: BG11018
UniProt: P40762
Position
3604993..3605502
Genome map
AA seq 169 aa AA seqDB search
MSDLTKQMIYDIYVRLLHLNEQKANTSLQQFFKEAAEEDVAEIPKNMTSIHVIDCIGQHE
PINNAGIARKMNLSKANVTKISTKLIKEEFINSYQLTDNKKEVYFKLTRKGRRIFDLHEK
LHKKKELAFYQFLDSFSQEEQKAVLKFLEQLTSTLEAEQTDGTPDKPVK
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatttgacaaaacagatgatatacgacatatacgtgagactgctgcaccttaat
gaacaaaaagcgaacacttcacttcagcaattttttaaggaggccgcagaagaggatgta
gctgaaattcccaaaaatatgacaagcattcacgtcattgactgcatcggccagcatgaa
cccattaataatgccggaattgccagaaaaatgaacttatcgaaagcgaatgtaacgaaa
atcagcacaaaactgatcaaggaagaattcattaacagctatcagctgacagataacaaa
aaagaagtttattttaaattaacccgtaaaggcagacggattttcgacttacatgagaaa
ctgcataaaaaaaaggagctggctttttaccaattcctcgattcattttcacaagaagaa
caaaaggctgtattgaagtttctagagcagttgacgtcaacacttgaagcagaacaaacc
gatgggactccagacaaacctgtaaagtaa

DBGET integrated database retrieval system