KEGG   Bacillus subtilis subsp. subtilis 168: BSU35090Help
Entry
BSU35090          CDS       T00010                                 

Gene name
yvmA
Definition
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_3 MFS_4 MFS_2 Sugar_tr LacY_symp DUF2583
Motif
Other DBs
NCBI-GeneID: 936643
NCBI-ProteinID: NP_391389
Pasteur: BG14120
BSORF: BG14120
UniProt: O34307
Position
3605523..3606734
Genome map
AA seq 403 aa AA seqDB search
MAHTKSKAVLILYTVCFSAFFASLSQNIYSPILPIIKESFHVSTAMVNLSVSVFMIVTAI
MQIILGAIIDFKGARIVLITGILATAAASIGCAVTTDFTLFLIFRMIQAAGSAALPLIAA
TTIGQLFTGNERGSAMGTYQMLLSVAPAIAPVLGGFIGGAAGYEGIFWILAAISIVLLVT
NSITFPKDSPTESMQQAKGNVFAHYKSIFTNRTGNVILTLSFVLFFIYFAVIVYLPILLT
EHYHIDVGIAGLLYLPLALSTIAGTFLFKRIQAKIGLHTLFIGSNVIAACSIILFAVTHS
VSLVLMALTLALFGISMGVIPPLYSTMITNEFEHNRGSAIGMFNFIRYTGMAAGPMVSAY
LLTMMPSAMSFSLLGLGFAALSFCLLPPMFSPQKRTKQKKHHM
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttggctcatacaaaatcaaaggcagtattgatcttatacactgtttgcttcagtgcattt
tttgcatctttaagccagaacatttattcacctattcttccgatcattaaagaatcattc
catgtttccacagctatggtgaacctgtcagtctcagtttttatgattgtgacagcaata
atgcaaattatattaggagcgatcattgattttaaaggcgctcggatcgtcttgattacc
ggtattctggcaacggcagcagccagcatcggctgtgcggtgactactgactttaccttg
tttctgatattcagaatgatacaggcagccggttccgcagcactgcctcttattgctgcc
acaacgatcggacagctgtttacaggaaatgaacgcgggagtgcaatgggaacgtatcaa
atgctcctgtctgtcgcaccggctattgctccagttctaggaggattcataggcggagca
gccggatacgaagggattttttggatacttgcggccatctctatcgttttgctggtgaca
aacagcatcacctttcctaaagattctccaactgaatctatgcagcaagccaaaggcaat
gtgttcgctcattataaatcaatatttacaaatcgaacagggaacgtcattttgacttta
agttttgttctctttttcatttattttgcagtaattgtctacctcccaatattgctgaca
gagcattaccatatagatgtgggtatagcaggactgttatatttgccgctggcgctgagc
acgattgcaggtacgtttctgtttaaaagaatacaggcaaaaatcgggctgcacaccttg
tttatcggaagcaatgtgattgccgcctgcagcatcattttatttgctgttacacattcc
gtttctctcgttctcatggctctgacgctggcactgtttggcatctcgatgggggttatt
cctcccttgtactctacaatgattactaatgaatttgagcacaacagagggagtgcaatc
ggaatgtttaactttatccgatatacaggcatggcagcaggtccgatggtatctgcctac
ttgctcacaatgatgccgtctgccatgtcctttagcctcctaggccttggatttgccgca
ttgagcttttgccttcttccgccaatgttttcgccgcagaagcgcacgaaacaaaaaaag
caccacatgtaa

DBGET integrated database retrieval system