KEGG   Bacillus subtilis subsp. subtilis 168: BSU35100Help
Entry
BSU35100          CDS       T00010                                 

Gene name
yvlD
Definition
(RefSeq) hypothetical protein
  KO
K08972  putative membrane protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BSU35100 (yvlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_holin_4_2
Motif
Other DBs
NCBI-GeneID: 936638
NCBI-ProteinID: NP_391390
Pasteur: BG14119
BSORF: BG14119
UniProt: O34648
Position
complement(3606762..3607121)
Genome map
AA seq 119 aa AA seqDB search
MVKWAVSILVNALLLIVIDGYIDSIHISSIGAAIIASLILSILNVLIKPLLIIFTLPVTM
VTLGLFLFVINAITLMMTASIMGDSFQIDGFGTAIWASVILSVFHLLIQKGILEPLRKK
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaatgggcagtcagcattttagtcaatgcattgttattaatcgtcattgatgga
tatattgactccatccatatcagcagcattggggcagcgattatcgccagcctcatttta
tcgatcttaaacgtgctgattaaaccgcttttaattatatttacactgccggtcaccatg
gtgacgcttggactcttcttgtttgtgattaacgccatcacgcttatgatgaccgcgtcc
attatgggtgacagctttcaaatcgacggcttcggcacagcgatatgggcatccgttatc
ctgtcggtcttccatttgctgattcaaaaaggcattttagagccgcttagaaaaaaataa

DBGET integrated database retrieval system