KEGG   Bacillus subtilis subsp. subtilis 168: BSU35120
Entry
BSU35120          CDS       T00010                                 

Symbol
yvlB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4097 DUF2154 DUF2680
Other DBs
NCBI-GeneID: 936656
NCBI-ProteinID: NP_391392
Pasteur: BG14117
BSORF: BG14117
UniProt: O34628 A0A6M3ZGE6
Position
complement(3607325..3608422)
AA seq 365 aa
MKQEKERILKLVEEGKLTAQEALTLIEKLDSDYKEKEEKITALSVHVHDEEEPFTTAKKE
SGKPSLGAKLFDWIDSAVKKVKEVDLDLNFGHAYDVQHIFQFKDTDFSSVELQIANGSVN
IVPWEDDDIRAECQAKVYRADSQDAARHAFLQHIECEIKGNKFFIRTEKKTMKTNVTLYI
PQKEYDKIRVKLFNGPVRGEHLHVKEFSAKTTNGVLSFSYLTAEKAIAETANGQIKLASH
SCGTIEAETINGLIDLRGKSESIDVQSFNGNIAINVTESDCRSIYAKTTTGNVELAIPDD
LAVKAELKSNLGTLSHELMDVEMLKEKNDTIQKEMMFTSNQAHDQNITVFSESLTGAIKL
KYSQR
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgaagcaagaaaaggaacgaatccttaagcttgttgaggaaggaaagcttacagcacaa
gaagctttgacactgattgaaaagcttgacagcgactacaaggaaaaagaagagaaaatc
acagcgctctcagttcacgttcatgacgaggaagagccatttacaacggcaaaaaaagaa
agcggcaaaccgtctttaggagccaagctgtttgactggattgattctgctgtgaaaaag
gtcaaggaagttgaccttgatttaaactttggccatgcgtatgatgttcagcacattttt
caatttaaagatactgacttttccagtgttgagctgcaaattgccaatggcagcgtaaat
atcgtcccttgggaagatgacgatatcagagcggaatgccaggcgaaggtatatcgcgct
gacagccaggatgcggcgagacacgcatttcttcagcatattgaatgtgaaatcaaaggt
aataagttttttatccgtactgagaaaaagacgatgaaaacgaatgtcactttgtatatt
cctcagaaggagtatgataagattcgggtgaagctgtttaacggtccagtcagaggggaa
catttacatgtaaaagagttctcagcgaaaacgacaaacggcgtgctgtcgttctcgtat
ttaacagccgaaaaagccatagctgaaacggccaacgggcaaattaagctcgcaagccac
agctgcggtacgatagaagcggaaaccattaacggattgatcgatctccgagggaaaagc
gaatccattgacgttcaaagctttaacggaaatattgcgattaacgtaacagaatcagac
tgccgctccatttatgcaaaaacaacgactggaaatgtagagcttgcaattccggacgat
ctcgcagtgaaggcagagctgaaaagcaatcttggtacgctgtcccatgaattaatggat
gtagagatgctgaaggaaaaaaatgatacgattcaaaaagaaatgatgttcacttcaaat
caggcacatgatcaaaacatcaccgtcttctcagaatcactaacaggcgccatcaaacta
aagtactcacagaggtga

DBGET integrated database retrieval system