KEGG   Bacillus subtilis subsp. subtilis 168: BSU35130Help
Entry
BSU35130          CDS       T00010                                 

Gene name
yvlA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4870 EBP CcmD DUF2070
Motif
Other DBs
NCBI-GeneID: 936640
NCBI-ProteinID: NP_391393
Pasteur: BG14116
BSORF: BG14116
UniProt: O34322
Position
complement(3608447..3608773)
Genome map
AA seq 108 aa AA seqDB search
MNRNQAIIASLCYFSVFIAPIIVPIVAYFVVNEKETKRHAIRSLISHIVPFVGWLFLFIA
LLGGAVAIDGDSLLPVFVIIGGAVIYFLVVIGIIIWNVIQGIKVLRAA
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccgtaatcaagctattattgcatcactttgttatttcagtgtgttcattgcgcca
atcattgtgccgattgtcgcatattttgttgtaaatgagaaagaaacaaaacgccatgcg
atacgctctcttatttctcacattgttccgtttgtcggctggctgttcctttttattgct
ttacttggcggagccgttgcgattgatggagacagcttgcttcctgtatttgtaatcatc
gggggagcggttatttatttcttagttgtcattggcattatcatttggaatgtgattcag
ggcattaaggtcctgcgtgcagcataa

DBGET integrated database retrieval system