KEGG   Bacillus subtilis subsp. subtilis 168: BSU35130
Entry
BSU35130          CDS       T00010                                 

Symbol
yvlA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4870 Clostridium_P47 CcmD DUF2070
Other DBs
NCBI-GeneID: 936640
NCBI-ProteinID: NP_391393
Pasteur: BG14116
BSORF: BG14116
UniProt: O34322 A0A6M4JPK7
Position
complement(3608447..3608773)
AA seq 108 aa
MNRNQAIIASLCYFSVFIAPIIVPIVAYFVVNEKETKRHAIRSLISHIVPFVGWLFLFIA
LLGGAVAIDGDSLLPVFVIIGGAVIYFLVVIGIIIWNVIQGIKVLRAA
NT seq 327 nt   +upstreamnt  +downstreamnt
ttgaaccgtaatcaagctattattgcatcactttgttatttcagtgtgttcattgcgcca
atcattgtgccgattgtcgcatattttgttgtaaatgagaaagaaacaaaacgccatgcg
atacgctctcttatttctcacattgttccgtttgtcggctggctgttcctttttattgct
ttacttggcggagccgttgcgattgatggagacagcttgcttcctgtatttgtaatcatc
gggggagcggttatttatttcttagttgtcattggcattatcatttggaatgtgattcag
ggcattaaggtcctgcgtgcagcataa

DBGET integrated database retrieval system