KEGG   Bacillus subtilis subsp. subtilis 168: BSU35140Help
Entry
BSU35140          CDS       T00010                                 

Gene name
yvkN
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 936649
NCBI-ProteinID: NP_391394
Pasteur: BG14115
BSORF: BG14115
UniProt: O34604
Position
3608991..3609221
Genome map
AA seq 76 aa AA seqDB search
MEKDPSDYTVTQESVLKLIQEQKRMNREMITELEQIHGPFPISHDIQYIKVLLDSSNTHI
VQDLMSVSKQLYKKTL
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagatcccagtgactatacagtaacacaagaatcagtgttaaagctgattcag
gaacaaaaaagaatgaatcgtgaaatgatcaccgagcttgagcagattcacggacccttc
ccgatctctcacgatatccaatatataaaagtgctgctcgacagcagcaacacacatatt
gttcaagatttaatgagtgtaagtaagcagctgtataagaagactttgtaa

DBGET integrated database retrieval system