KEGG   Bacillus subtilis subsp. subtilis 168: BSU35180
Entry
BSU35180          CDS       T00010                                 

Symbol
csbA
Name
(RefSeq) general stress protein CsbA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2198 DUF3792 SecD_SecF DUF2070
Other DBs
NCBI-GeneID: 936675
NCBI-ProteinID: NP_391398
Pasteur: BG10501
BSORF: BG10501
UniProt: P37953 A0A6M4JPM1
Position
complement(3615116..3615346)
AA seq 76 aa
MITKAVFALFFPFMLVVLFTRVTFNHYVAIALTAALLFASYLKGYTETYFIVGLDVVSLV
AGGLYMAKKAAEKKEE
NT seq 231 nt   +upstreamnt  +downstreamnt
ttgattacaaaagccgtttttgcattgtttttcccttttatgcttgttgttctatttact
agagtcacctttaatcattatgtggcgatcgctttaacagctgcattgctgtttgcctct
tatttaaaaggctatacagaaacgtattttattgtaggattggatgttgtgtctcttgtg
gctggcggactgtatatggccaaaaaagctgcagagaaaaaagaagaataa

DBGET integrated database retrieval system