KEGG   Bacillus subtilis subsp. subtilis 168: BSU35190Help
Entry
BSU35190          CDS       T00010                                 

Gene name
yvkC
Definition
(RefSeq) phosphotransferase YvkC
  KO
K01007  pyruvate, water dikinase [EC:2.7.9.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00620  Pyruvate metabolism
bsu00680  Methane metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSU35190 (yvkC)
  09102 Energy metabolism
   00680 Methane metabolism
    BSU35190 (yvkC)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.2  pyruvate, water dikinase
     BSU35190 (yvkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PPDK_N PEP-utilizers
Motif
Other DBs
NCBI-GeneID: 936657
NCBI-ProteinID: NP_391399
Pasteur: BG14114
BSORF: BG14114
UniProt: O34796
Position
3615793..3618288
Genome map
AA seq 831 aa AA seqDB search
MYSVLFRQAEESSQLAGAKGMNLIKLTKHGLPVPDGFIIQTNALARFMEDNQLQETSENV
EGGIISGTFSDELKDELTSSFYKLRESYRSVAVRSSSASEDLEGASFAGQYETYLNIKTE
EEFLAKVKECWASFFSGRVSSYKKKMNNQIAEPLMGIVVQGLIDSEMSGVIFSRNPVTHD
DRELLISASYGLGEAVVSGNVTPDTFIVNKSSFEIQKEIGAKEIYMESAAEGIAEKETSE
DMRSRFCLTDEQVIELAEITKKTEDLYGYPVDIEFGIADHQIYLLQARPITTIDQDKKAA
EEKRSFMITDTDMNDFWLNMESNIEGPVSPLFSSFIVPALEYGLKKSMQKFPIGVVVDEV
KLYRGHIYSKNQGGQQPPSEDCGKELFPILSEHMYDIINHTYLPFYRTLDQLAQTEHTAE
SALEAFQKLKAFYLTAYEEHFNIVFPQILLTNKLQAMYQDIQGESENAHFYEMLTGKMNK
SLETDRCLWLFSVEVQENPNLLAIFENNKPEQLQEKLEQTDEGRHFLKNVHEFLQEYGWR
SVKSHDLIEQIWVENPYFALANIQNYVRNGYHFDNEFQKTKEKREKLYNEFLESIEDPGL
RTEFDRYYQWTLNSANIKDDHHFYIDAMLDAKARIFLLKIGELLAENGVIQDREDLWFLY
DDEVEQALLHPVSLQEKAEKRRQIFHEYELAQAPAYLGTPTKEQLKAAEEIVGAVIEDEK
NTENHIFGIAASSGIATGPVKIIRDANEFSQFAPGDVLVCKMTTPLWTSLFQDAKAIITD
TGGILSHAAIIAREYGIPAVLGTRTATERLRDGDIITVDGSSGKITVVSRS
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgtattctgttttatttcgccaggcagaagagtccagccagctggctggagcaaaagga
atgaatttgattaaattgaccaaacacggtcttcctgttccggacgggtttattattcaa
acgaatgcgctcgcacgttttatggaggacaaccagcttcaagagactagtgaaaacgtc
gaaggcgggatcatttccggaacattttcggatgagctgaaagatgagctgactagttcc
ttttataagcttagagaatcatatcgatccgtagccgtgcgttcttcgtctgcttcggaa
gatttagaaggcgcctcattcgcgggtcaatatgaaacctacttaaatatcaaaacagag
gaagagtttctggctaaagtgaaagaatgctgggcctcatttttttctgggcgggtcagc
agctataagaaaaaaatgaacaatcaaatcgcagagccgttaatgggaatagtcgttcag
gggctgatcgattcagaaatgtcaggtgttatcttcagccgcaaccctgttacccatgat
gatagagagcttttaatcagcgccagctacgggttgggtgaagctgttgtttcaggaaat
gttaccccagacacgttcattgttaataaatcttcgtttgagattcagaaagaaataggt
gcaaaggaaatctacatggagtctgcggcagaaggaattgctgaaaaagaaacgagtgaa
gacatgcgcagccgtttttgccttacagatgaacaagtgattgaattggctgaaatcaca
aaaaaaaccgaagacctgtacggatatcctgttgatatagaatttggaattgctgatcat
caaatataccttctgcaagctcgcccgattacaaccattgatcaggacaaaaaagcggca
gaagaaaaacgcagcttcatgattaccgacactgatatgaatgatttctggcttaacatg
gagtctaatattgaaggtccggtgagtccgttattttcatccttcatcgtgccggcattg
gaatatggcttgaagaagagcatgcaaaagtttccgattggtgtagttgttgatgaagta
aaactttatcgcggacatatttattccaaaaaccaaggcggacagcagcctccttctgaa
gactgcggcaaagagcttttcccgattttatcggagcatatgtatgacatcatcaatcac
acatacctccctttttaccggacactggaccagctcgcacaaactgagcataccgcagaa
agcgcactggaagcttttcaaaaactaaaggccttttatctcacggcttatgaagagcac
tttaatatcgttttcccgcaaatccttttaacaaacaaactgcaagcgatgtatcaggac
attcaaggagagtccgaaaacgctcatttttacgagatgctgacaggaaaaatgaacaaa
tcactggaaacggaccgttgcttatggctattttctgtggaagttcaggagaacccgaac
cttctggccatttttgaaaacaacaagcctgaacagctccaggagaaattggaacaaaca
gatgagggaagacacttcctgaagaacgtccatgaattcttgcaagaatacggatggaga
tctgttaaaagtcatgatctgattgaacaaatctgggtggaaaatccgtatttcgctctg
gccaatattcaaaattatgtccgtaatggctatcattttgacaatgaatttcagaaaaca
aaagaaaaacgagagaaattatacaatgaattcttggaaagcatagaagatcccggttta
cgcaccgaatttgaccgctattatcaatggacactgaactctgcaaatataaaagatgat
caccacttttatattgacgccatgctggatgccaaggcgagaatctttctgctgaagata
ggtgaattgctggcggaaaacggtgtcattcaagatcgggaggacctttggttcttatat
gacgacgaagtggaacaagcgcttcttcaccctgtatccctgcaagaaaaggctgaaaaa
cgcagacagatttttcatgagtatgagctggcccaagccccggcctacctcggcaccccg
acaaaagaacagctcaaagcagctgaagaaattgtcggcgctgtgatagaggatgaaaaa
aacacagagaatcatatttttggcattgcggcatcaagcggcattgcgacaggtccggtg
aaaatcattcgggacgccaatgaattttctcaattcgcgcctggagacgtactcgtttgc
aagatgaccacaccgctatggaccagcctgtttcaagacgccaaagcgattattacagac
acaggcggcattttgtctcacgctgcgattattgcccgtgaatacggcattccagccgtt
ctcggcacacgcacggcaaccgaaagactgcgagacggtgacatcatcactgttgacgga
agcagcggcaaaatcacagttgtcagccggtcctga

DBGET integrated database retrieval system