KEGG   Bacillus subtilis subsp. subtilis 168: BSU35200Help
Entry
BSU35200          CDS       T00010                                 

Gene name
yvkB
Definition
(RefSeq) HTH-type transcriptional regulator YvkB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N HTH_Tnp_1_2 HTH_11 HTH_29 LacI HTH_6 HAD_2 RELT HTH_DeoR HTH_23 TrmB TnsD GerE HTH_24
Motif
Other DBs
NCBI-GeneID: 936683
NCBI-ProteinID: NP_391400
Pasteur: BG14113
BSORF: BG14113
UniProt: O34643
Position
3618364..3618933
Genome map
AA seq 189 aa AA seqDB search
MRPTNKRILDAAMQLLVKKGYRATTTKEIAEKANVSEATIFRNFKNKQGLVEALLSQHSS
NRGSILEQTEGDLYKDLLHIGTCLLEELEHRKDIIKISFREPAMFQDVINHVTEYPQSMK
QLLVDYLKTMGEKGVIQTGNEAEHADVFMSIIFGYFIHRLHLGDRVISMPQEKMLEHSTA
LFVKGISAD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttgagaccgacaaacaagagaatccttgatgctgccatgcagctgctcgtcaaaaaagga
tatcgcgcaacgactacaaaagaaattgcagaaaaagcaaatgtaagtgaagcgacgatt
ttcaggaactttaaaaacaaacaaggactagttgaggctttgctttctcagcattcttca
aacagaggcagcattttggaacaaacagaaggggatttgtacaaagacctgcttcatatc
ggaacctgtctcttggaggagctcgaacatagaaaagatatcattaaaatcagctttcgt
gaaccggccatgtttcaggatgtcattaaccacgtcactgaatatccccaatctatgaaa
cagctattggttgattatctcaaaacgatgggtgagaaaggggttattcagacaggaaat
gaagcggaacatgccgacgtgttcatgtcgattatcttcggttatttcattcaccgtctc
cacttaggagaccgggtcatatcaatgccccaggaaaaaatgctggagcatagcacagct
ctatttgtcaaaggaatttctgctgattaa

DBGET integrated database retrieval system