KEGG   Bacillus subtilis subsp. subtilis 168: BSU35210Help
Entry
BSU35210          CDS       T00010                                 

Gene name
yvkA
Definition
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_3
Motif
Other DBs
NCBI-GeneID: 938566
NCBI-ProteinID: NP_391401
Pasteur: BG14112
BSORF: BG14112
UniProt: O34502
Position
3618964..3620298
Genome map
AA seq 444 aa AA seqDB search
MSSRKEWALIVSLLLGAILVPINSTMIAVALSSISHTYNESIASITWVVTVYLIVMAVTQ
PIAGKLGDMYGNKTMYLWGVGLFLIASLGCALSPSLLLLIVFRALQAVGGALLTPNSIAI
IRHVVSEKRLPKVFGFFGLGAGLGAALGPFIGSILIDSFSWHSIFWVNIPFLAIALFTAL
TMFPQYKENKSDAPLDIIGSLLLAGSIVSIILLTKNEAPWGYTVYSVLILLFVPLFFRRE
KRTQHPIIDFALFKSSTFTNANLSVLLSNLMMYAVLLIMPLFMTNQFGLNTSNSGMALSV
FSIFMSASNWVGAQLHHKWGAKKIIFLSFAMMAGANLLFLLLSSSHSVLFLMLSLILGGL
ASGVGLTSMQVSSLATVDPGMSGVASGIFSTFRYFGSIISSALIGLISGYHTLFMILFAV
SIIGVFVSLGIKSDETARIEKNSA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgagctcaagaaaagaatgggcgctgatcgtctcgctattattgggggccattctggtt
cccattaactcaacgatgatcgcggtcgcgctctcatctatttcccatacgtataacgag
tccatcgcaagcatcacttgggtggttaccgtttatttaatcgtgatggcagtcacacag
ccgattgcaggaaagctcggtgacatgtacggcaataaaacaatgtacttatggggagtc
ggcctttttctaatcgcatctctaggctgcgccctttcaccgagtctgctcctgttaatt
gtctttcgggcattgcaggctgtcggcggggcattgcttacgccaaacagcattgccatt
atccggcatgttgtttctgaaaaacgcctaccgaaagtgtttggatttttcggactgggc
gcgggacttggtgcagcactcgggccttttatcggctctatactgattgacagcttcagc
tggcattcgattttttgggtcaacatcccgttcctcgccattgctttatttacggcatta
acgatgtttcctcaatataaagaaaataaatctgacgcgccgctggatatcatcggctct
ctcttgcttgcaggcagcatcgtttccattatcctgctgacgaaaaatgaggctccatgg
ggatatactgtatacagtgtattgatacttctttttgttccgctttttttcagaagagaa
aaacgtacccagcaccccatcattgactttgcactgtttaaaagctcaacctttacaaat
gcgaatctatcagtcttgttaagcaatttgatgatgtatgccgtcttattgattatgccg
ttatttatgacgaaccaatttgggcttaatacatctaacagcgggatggcgctttctgta
ttttcgatcttcatgtcagccagcaactgggtgggcgcgcagctccatcacaaatgggga
gccaaaaaaatcatttttctttcatttgccatgatggctggtgcgaatctattatttttg
ctgttaagcagctcgcattctgtcttgttcctcatgctctctcttatccttggcgggctc
gcttccggagtcggtctgaccagcatgcaggtttcatcccttgccacagtagaccccggt
atgtcaggagtggcatctgggattttctcgaccttccgttatttcggaagcatcatttca
tcagccttaattggcctgatttcgggatatcacaccctatttatgattctctttgctgta
tccatcatcggcgtttttgtttcattgggcatcaaatctgatgaaacggcacggatagaa
aaaaactcagcgtaa

DBGET integrated database retrieval system