KEGG   Bacillus subtilis subsp. subtilis 168: BSU35220Help
Entry
BSU35220          CDS       T00010                                 

Gene name
minJ
Definition
(RefSeq) cell division topological determinant MinJ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDZ_6 PDZ_2 PDZ Tricorn_PDZ PDZ_1
Motif
Other DBs
NCBI-GeneID: 936668
NCBI-ProteinID: NP_391402
Pasteur: BG14111
BSORF: BG14111
UniProt: O34375
Position
complement(3620346..3621539)
Genome map
AA seq 397 aa AA seqDB search
MSVQWGIELLKSAGLFFLHPLFWFFIIITLAFGYVRIKRERKTFHTRIADIYDDLKFTYT
KGLIPGLLLSVILGGLGISIPLGLLAIIAVITAAAAFTLRANWMSAAYIVSVSMLIGFGL
QIYQAEPFLERFPQGFAVVWPAVAVFLGLLIITEGAVAYRSAHVRTSPALVVSSRGLPIG
QQLANRVWLLPLFLLVPGNGLESHLSWWPVFTVPGGSFHFLWIPYFVGFGQRVQGSLPET
SIRITAKRVCILGLAVAVLGAASLLWTPLAGAAVCTALLGRIFLSIKQRVNDNAAPFYFS
KRDQGLMVLGIIPNTPAEDLELKIGEIITKVNGIPVKNVSDFYEALQHNRAYVKLEIIGL
NGEIRFDQRASYEGEHHELGILFVKDDREDEAVASGS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgttcaatggggaattgaactgttaaaaagcgcgggcttgttcttcttacacccg
cttttctggttttttatcatcataaccttggctttcggctatgtaagaatcaaacgggaa
cgaaaaacctttcatacaagaatagcagatatttatgatgatctgaaatttacatataca
aagggactgattccaggtcttcttttgtcagttattttaggtggactcggaatatcgatt
cctctcggtttacttgcgattattgccgttatcactgcagcggcagcgttcactcttcgc
gcaaactggatgtctgctgcatatatcgtcagtgtgagtatgctgataggttttggactg
caaatatatcaggcggagccctttctggagagatttccgcaaggatttgcagttgtttgg
ccggctgtggctgtgtttctaggtttgctgattatcactgaaggagcggttgcttatcgt
tctgcgcatgtgagaacatcaccggcacttgtcgtaagcagccgcggtttgccgatcgga
cagcagctggcaaaccgggtttggcttttgccgctgttccttctcgtgcccggtaatggt
ttagaatcgcaccttagctggtggcccgtgtttacggttcccggcggctcattccatttt
ctatggattccttactttgtcggatttggacaaagggtacagggatcgctgcctgaaacg
agtataaggatcacagcgaaacgcgtttgtattctcggtcttgccgtcgcagttctcggt
gcagcgagcttactgtggacgccgcttgcgggtgcagcggtctgtaccgctttgttaggg
cgtatttttctgtccataaagcaaagagtgaatgataacgcggctccgttttatttctcg
aaaagggatcagggcttaatggtgcttgggattatccccaatacgccggctgaggatctg
gaattgaaaatcggggaaatcataacgaaagtcaatggcataccggttaagaacgtttct
gatttctatgaagcgcttcagcataaccgtgcatatgtaaagcttgaaattatcggtttg
aatggagaaattcgttttgaccagcgagcttcttatgaaggagaacatcatgaattgggc
atcctcttcgtaaaggatgaccgtgaagacgaagcagtcgcttcgggatcataa

DBGET integrated database retrieval system