KEGG   Bacillus subtilis subsp. subtilis 168: BSU35250Help
Entry
BSU35250          CDS       T00010                                 

Gene name
ftsX
Definition
(RefSeq) cell division protein FtsX
  KO
K09811  cell division transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Module
bsu_M00256  Cell division transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU35250 (ftsX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU35250 (ftsX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU35250 (ftsX)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BSU35250 (ftsX)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Cell division transporter [MD:M00256]
    BSU35250 (ftsX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsX_ECD FtsX YebO Saf_2TM DUF2976 DUF2304
Motif
Other DBs
NCBI-GeneID: 936708
NCBI-ProteinID: NP_391405
Pasteur: BG12591
BSORF: BG12591
UniProt: O34876
Position
complement(3623938..3624828)
Genome map
AA seq 296 aa AA seqDB search
MIKILGRHLRESFKSLGRNTWMTFASISAVTVTLILVGVFLVIMLNLNNMATNAEKQVEI
KVLIDLTADQKAQDKLQNDIKELKGIQSVTFSSKEKELDQLVDSFGDSGKSLTMKDQENP
LNDAFVVKTTDPHDTPNVAKKIEKMDHVYKVTYGKEEVSRLFKVVGVSRNIGIALIIGLV
FTAMFLISNTIKITIFARRKEIEIMKLVGATNWFIRWPFFLEGLLLGVFGSVIPIALVLS
TYQYVIGWVVPKVQGSFVSLLPYNPFVFQVSLVLIAIGAVIGVWGSLTSIRKFLRV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaattctcgggcgccacttgcgtgagagttttaaatctctcgggagaaacaca
tggatgacatttgcatccattagtgctgtaaccgttacgctgattttagtcggcgtgttt
ttagtgattatgctgaatttgaataacatggccacgaatgcagaaaaacaagtcgaaatc
aaagtgctgattgatctgactgcagatcagaaggcacaggacaagcttcagaacgatatt
aaggaactgaagggcattcagagtgtcactttttcatctaaagaaaaagagcttgaccag
ctggttgacagttttggtgacagcggaaaatccctgacaatgaaggatcaggaaaacccg
cttaatgatgcgtttgtcgtcaaaacgacagatccgcatgatacgccgaacgtggcgaaa
aagatcgaaaaaatggatcatgtttataaagtcacttatggaaaagaagaggtcagccgt
ttgtttaaagtggtcggcgtttcccgcaacatcggaatcgcgttaattatcggcctggta
tttacggcgatgttcttaatttccaacaccattaaaattacaattttcgcaagaagaaaa
gaaattgaaatcatgaagcttgtcggcgcgacaaactggtttatccgctggccgtttttc
cttgaaggattgctgctaggcgtattcggttctgtgattccgattgcactggtgctgagc
acttaccaatacgtcatcggatgggtcgttccaaaggttcaaggatcatttgtctctctt
cttccttataatccatttgtattccaagtttcgctagtgctgattgcaatcggcgcagta
attggagtatggggaagtctgacttccatccgcaagtttctgcgagtataa

DBGET integrated database retrieval system