KEGG   Bacillus subtilis subsp. subtilis 168: BSU35260
Entry
BSU35260          CDS       T00010                                 

Symbol
ftsE
Name
(RefSeq) cell division ATP-binding protein FtsE
  KO
K09812  cell division transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU35260 (ftsE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU35260 (ftsE)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU35260 (ftsE)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BSU35260 (ftsE)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Cell division transporter
    BSU35260 (ftsE)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_33 AAA_22 AAA_16 RsgA_GTPase AAA_29 cobW MMR_HSR1 NB-ARC RNA_helicase Septin AAA_24 ATPase_2 AAA_30 AAA_14 Rad17 Dynamin_N ATP_bind_1 Zeta_toxin Sigma54_activat AAA_18 TsaE AAA
Other DBs
NCBI-GeneID: 936681
NCBI-ProteinID: NP_391406
Pasteur: BG12590
BSORF: BG12590
UniProt: O34814 A0A6M4JPQ4
Position
complement(3624821..3625507)
AA seq 228 aa
MIEMKEVYKAYPNGVKALNGISVTIHPGEFVYVVGPSGAGKSTFIKMIYREEKPTKGQIL
INHKDLATIKEKEIPFVRRKIGVVFQDFKLLPKLTVFENVAFALEVIGEQPSVIKKRVLE
VLDLVQLKHKARQFPDQLSGGEQQRVSIARSIVNNPDVVIADEPTGNLDPDTSWEVMKTL
EEINNRGTTVVMATHNKEIVNTMKKRVIAIEDGIIVRDESRGEYGSYD
NT seq 687 nt   +upstreamnt  +downstreamnt
atgatagagatgaaggaagtatataaagcctatccgaacggcgtaaaagcactcaatggg
atttctgttaccattcatcccggcgagtttgtgtatgttgttggtccgagcggagcaggt
aaatctacttttattaaaatgatttacagagaagaaaaaccgacaaaaggacaaatttta
atcaatcataaagatctcgcgacaattaaagaaaaagagattcctttcgtgcgccgcaaa
ataggtgttgtctttcaggatttcaagcttcttccgaaacttactgtttttgaaaatgtg
gcatttgcccttgaagtgattggagaacagccgtctgtcattaagaaacgggtgcttgaa
gtgcttgatctcgtgcagctgaagcataaagcgcgacaatttcctgaccagctttcaggc
ggggagcagcagcgtgtatctattgccagatcaattgtgaacaaccctgatgttgtcatt
gctgatgaaccgacaggaaaccttgatccggatacgtcctgggaagtcatgaagacgctg
gaggaaattaacaaccgcgggacaacagtcgtgatggcgacacataataaagaaatcgta
aacaccatgaagaaacgtgtcattgcaatcgaagatggtatcattgtgcgtgatgagtca
agaggggagtatggttcatatgattaa

DBGET integrated database retrieval system