KEGG   Bacillus subtilis subsp. subtilis 168: BSU35270Help
Entry
BSU35270          CDS       T00010                                 

Gene name
cccB
Definition
(RefSeq) cytochrome c-551
  KO
K12263  cytochrome c551
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    BSU35270 (cccB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrome_CBB3 Cytochrom_C GRP
Motif
Other DBs
NCBI-GeneID: 936703
NCBI-ProteinID: NP_391407
Pasteur: BG12574
BSORF: BG12574
UniProt: O34594
Position
complement(3625741..3626079)
Genome map
AA seq 112 aa AA seqDB search
MKSKLSILMIGFALSVLLAACGSNDAKEEKTDTGSKTEATASEGEELYQQSCVGCHGKDL
EGVSGPNLQEVGGKYDEHKIESIIKNGRGNMPKGLVDDNEAAVIAKWLSEKK
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaaagttatcgatactaatgattggatttgcgctttctgttctgttggctgcc
tgcggatcaaacgatgcaaaagaagagaagacagacactggcagcaagacggaagccact
gcatctgaaggggaagaattatatcagcaaagctgcgtaggctgccacggcaaggattta
gaaggtgtgtcagggcctaatctccaagaggtcggaggcaaatacgatgaacacaaaatt
gaaagcattattaaaaacggccgcggcaatatgccaaaggggcttgtagatgataacgaa
gccgctgttattgccaaatggctgtcagaaaaaaagtaa

DBGET integrated database retrieval system