KEGG   Bacillus subtilis subsp. subtilis 168: BSU35280
Entry
BSU35280          CDS       T00010                                 

Symbol
yvjA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YitT_membrane DUF2179
Other DBs
NCBI-GeneID: 938534
NCBI-ProteinID: NP_391408
Pasteur: BG14109
BSORF: BG14109
UniProt: O34792 A0A6M4JPN1
Position
complement(3626128..3626973)
AA seq 281 aa
MDVRNKTLWILRDYVYILIGAAITAVSFNVFLLPNKIAAGGVSGISTILQSYGFEAAYVQ
WIINIPLFIAGVILLGGKFGLKTLAGSVFLPLVVFLTRDIQPATHHELLAAIFGGVGIGI
GIGIVYLGKGSTGGTALAAQIIHKYSGLSLGKCLAIIDGMIVVTAMIVFNIEQGLYAMLG
VYVSSKTIDVVQVGFNRSKMALIITKQEQAVKEAVLQKIDRGVTKISAVGGYTDDDRPIL
MCVVGQTEFTKLKQIVKQIDESAFVIVADASEVLGEGFKRA
NT seq 846 nt   +upstreamnt  +downstreamnt
atggacgtacggaataaaacattgtggattttgcgggattatgtatacatattgatagga
gcagcgattacggccgtgtcctttaatgtatttttgcttccgaataagattgccgccggc
ggggtcagcgggatcagtacgattttacaatcatatggttttgaagcagcgtatgtacag
tggattattaatatccctttatttattgctggcgtcattttgctcggcgggaaatttgga
ctaaagacgcttgcaggttctgtgtttttgccgctagtagtgtttctgacaagggatatt
cagcccgccactcatcatgaactcctggcggcgatttttggcggtgtcgggataggtatc
ggaattggtattgtgtacttagggaaaggttcgacgggaggtacagccttggctgcacag
atcattcataagtactccggtctgtcattggggaagtgtctcgccatcattgacggaatg
atcgttgttacggctatgattgtatttaatattgagcaaggcttatatgccatgcttggc
gtctatgtgtccagcaaaaccattgatgttgtgcaagtcggctttaatcgttcaaaaatg
gcgctcatcattacaaagcaggagcaggctgtcaaggaggctgtcttacagaagattgac
agaggcgtgacaaaaatttctgcagtcggcggatatactgacgatgaccgtccgatttta
atgtgcgtggttgggcaaactgaattcaccaaattgaaacaaatcgtcaaacagattgat
gagtcagcttttgtaattgtagcagacgcgagcgaggtgctgggcgagggtttcaaacgc
gcttaa

DBGET integrated database retrieval system