KEGG   Bacillus subtilis subsp. subtilis 168: BSU35290
Entry
BSU35290          CDS       T00010                                 

Symbol
prfB
Name
(RefSeq) peptide chain release factor 2
  KO
K02836  peptide chain release factor 2
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bsu03012]
    BSU35290 (prfB)
Translation factors [BR:bsu03012]
 Prokaryotic type
  Release factors
   BSU35290 (prfB)
SSDB
Motif
Pfam: PCRF RF-1 QueF MIR ERM_C Com_YlbF
Other DBs
NCBI-GeneID: 936692
NCBI-ProteinID: NP_391409
Pasteur: BG10742
BSORF: BG10742
UniProt: P28367 A0A6M4JPM9
Structure
Position
complement(join(3627139..3628167,3628169..3628240))
AA seq 366 aa
MELSEIRAELENMASRLADFRGSLDLESKEARIAELDEQMADPEFWNDQQKAQTVINEAN
GLKDYVNSYKKLNESHEELQMTHDLLKEEPDTDLQLELEKELKSLTKEFNEFELQLLLSE
PYDKNNAILELHPGAGGTESQDWGSMLLRMYTRWGERRGFKVETLDYLPGDEAGIKSVTL
LIKGHNAYGYLKAEKGVHRLVRISPFDSSGRRHTSFVSCEVMPEFNDEIDIDIRTEDIKV
DTYRASGAGGQHVNTTDSAVRITHLPTNVVVTCQTERSQIKNRERAMKMLKAKLYQRRIE
EQQAELDEIRGEQKEIGWGSQIRSYVFHPYSMVKDHRTNTEMGNVQAVMDGDIDTFIDAY
LRSKLS
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggaattatcagaaattagagcagagctcgaaaatatggcttctcgtttagcggacttt
agggggtctcttgacctcgaatcaaaggaggcccgcattgctgagctagatgaacaaatg
gctgatccggaattctggaatgatcagcaaaaagctcaaacggttataaatgaagcaaac
ggtttaaaggattatgtcaattcgtataaaaaattgaatgaatcccacgaagaattacaa
atgactcatgatcttttgaaagaagagccggacactgatctccagcttgagcttgaaaaa
gaactaaagtcattaacaaaagagttcaatgagtttgagcttcagcttcttctcagcgag
ccgtatgataaaaataacgcgattttagaactgcaccctggtgctggcggtacagagtca
caggactggggctctatgcttcttagaatgtatacaagatggggagagcgccgcggcttt
aaagtagagactctcgattaccttccaggtgacgaggcgggaatcaagtcagtgacattg
ctcatcaaaggacacaacgcttacgggtatctcaaagcagaaaaaggtgttcatcgtctt
gtgcggatctcaccatttgattcatcaggccgccgccacacatctttcgtttcatgtgaa
gtcatgcctgaatttaacgatgaaattgatattgatattcgtacggaggatattaaagtt
gacacgtaccgtgcaagcggcgcgggcggacagcacgtcaatacgacggattcagccgtt
cggattactcacttgccgacgaacgtagttgtgacatgccaaacggagcgctcacaaatt
aaaaaccgtgaaagagccatgaaaatgctgaaggccaagctgtatcagcgcagaattgaa
gagcagcaggcagagctggatgaaattcgcggtgaacaaaaagaaatcggctggggcagc
caaatccgttcttatgtattccatccgtattccatggtaaaagaccatcggaccaataca
gaaatggggaacgttcaagctgtaatggatggtgacattgatacgtttattgatgcctac
ctgcgttctaagctttcataa

DBGET integrated database retrieval system