KEGG   Bacillus subtilis subsp. subtilis 168: BSU35300Help
Entry
BSU35300          CDS       T00010                                 

Gene name
secA
Definition
(RefSeq) protein translocase subunit SecA
  KO
K03070  preprotein translocase subunit SecA [EC:7.4.2.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
bsu03060  Protein export
bsu03070  Bacterial secretion system
Module
bsu_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BSU35300 (secA)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BSU35300 (secA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU35300 (secA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU35300 (secA)
Enzymes [BR:bsu01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     BSU35300 (secA)
Secretion system [BR:bsu02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   BSU35300 (secA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecA_DEAD SecA_SW SecA_PP_bind SEC-C DEAD Helicase_C Annexin
Motif
Other DBs
NCBI-GeneID: 936711
NCBI-ProteinID: NP_391410
Pasteur: BG10741
BSORF: BG10741
UniProt: P28366
Structure
PDB: 

Position
complement(3628310..3630835)
Genome map
AA seq 841 aa AA seqDB search
MLGILNKMFDPTKRTLNRYEKIANDIDAIRGDYENLSDDALKHKTIEFKERLEKGATTDD
LLVEAFAVVREASRRVTGMFPFKVQLMGGVALHDGNIAEMKTGEGKTLTSTLPVYLNALT
GKGVHVVTVNEYLASRDAEQMGKIFEFLGLTVGLNLNSMSKDEKREAYAADITYSTNNEL
GFDYLRDNMVLYKEQMVQRPLHFAVIDEVDSILIDEARTPLIISGQAAKSTKLYVQANAF
VRTLKAEKDYTYDIKTKAVQLTEEGMTKAEKAFGIDNLFDVKHVALNHHINQALKAHVAM
QKDVDYVVEDGQVVIVDSFTGRLMKGRRYSEGLHQAIEAKEGLEIQNESMTLATITFQNY
FRMYEKLAGMTGTAKTEEEEFRNIYNMQVVTIPTNRPVVRDDRPDLIYRTMEGKFKAVAE
DVAQRYMTGQPVLVGTVAVETSELISKLLKNKGIPHQVLNAKNHEREAQIIEEAGQKGAV
TIATNMAGRGTDIKLGEGVKELGGLAVVGTERHESRRIDNQLRGRSGRQGDPGITQFYLS
MEDELMRRFGAERTMAMLDRFGMDDSTPIQSKMVSRAVESSQKRVEGNNFDSRKQLLQYD
DVLRQQREVIYKQRFEVIDSENLREIVENMIKSSLERAIAAYTPREELPEEWKLDGLVDL
INTTYLDEGALEKSDIFGKEPDEMLELIMDRIITKYNEKEEQFGKEQMREFEKVIVLRAV
DSKWMDHIDAMDQLRQGIHLRAYAQTNPLREYQMEGFAMFEHMIESIEDEVAKFVMKAEI
ENNLEREEVVQGQTTAHQPQEGDDNKKAKKAPVRKVVDIGRNAPCHCGSGKKYKNCCGRT
E
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atgcttggaattttaaataaaatgtttgatccaacaaaacgtacgctgaatagatacgaa
aaaattgctaacgatattgatgcgattcgcggagactatgaaaatctctctgacgacgca
ttgaaacataaaacaattgaatttaaagagcgtcttgaaaaaggggcgacaacggatgat
cttcttgttgaagctttcgctgttgttcgagaagcttcacgccgcgtaacaggcatgttt
ccgtttaaagtccagctcatggggggcgtggcgcttcatgacggaaatatagcggaaatg
aaaacaggggaagggaaaacattaacgtctaccctgcctgtttatttaaatgcgttaacc
ggtaaaggcgtacacgtcgtgactgtcaacgaatacttggcaagccgtgacgctgagcaa
atggggaaaattttcgagtttctcggtttgactgtcggtttgaatttaaactcaatgtca
aaagacgaaaaacgggaagcttatgccgctgatattacttactccacaaacaacgagctt
ggcttcgactatttgcgtgacaatatggttctttataaagagcagatggttcagcgcccg
cttcattttgcggtaatagatgaagttgactctattttaattgatgaagcaagaacaccg
cttatcatttctggacaagctgcaaaatccactaagctgtacgtacaggcaaatgctttt
gtccgcacgttaaaagcggagaaggattacacgtacgatatcaaaacaaaagctgtacag
cttactgaagaaggaatgacgaaggcggaaaaagcattcggcatcgataacctctttgat
gtgaagcatgtcgcgctcaaccaccatatcaaccaggccttaaaagctcacgttgcgatg
caaaaggacgttgactatgtagtggaagacggacaggttgttattgttgattccttcacg
ggacgtctgatgaaaggccgccgctacagtgaggggcttcaccaagcgattgaagcaaag
gaagggcttgagattcaaaacgaaagcatgaccttggcgacgattacgttccaaaactac
ttccgaatgtacgaaaaacttgccggtatgacgggtacagctaagacagaggaagaagaa
ttccgcaacatctacaacatgcaggttgtcacgatccctaccaacaggcctgttgtccgt
gatgaccgcccggatttaatttaccgcacgatggaaggaaagtttaaggcagttgcggag
gatgtcgcacagcgttacatgacgggacagcctgttctagtcggtacggttgccgttgaa
acatctgaattgatttctaagctgcttaaaaacaaaggaattccgcatcaagtgttaaat
gccaaaaaccatgaacgtgaagcgcagatcattgaagaggccggccaaaaaggcgcagtt
acgattgcgactaacatggcggggcgcggaacggacattaagcttggcgaaggtgtaaaa
gagcttggcgggctcgctgtagtcggaacagaacgacatgaatcacgccggattgacaat
cagcttcgaggtcgttccggacgtcagggagacccggggattactcaattttatctttct
atggaagatgaattgatgcgcagattcggagctgagcggacaatggcgatgcttgaccgc
ttcggcatggacgactctactccaatccaaagcaaaatggtatctcgcgcggttgaatcg
tctcaaaaacgcgtcgaaggcaataacttcgattcgcgtaaacagcttctgcaatatgat
gatgttctccgccagcagcgtgaggtcatttataagcagcgctttgaagtcattgactct
gaaaacctgcgtgaaatcgttgaaaatatgatcaagtcttctctcgaacgcgcaattgca
gcctatacgccaagagaagagcttcctgaggagtggaagcttgacggtctagttgatctt
atcaacacaacttatcttgatgaaggtgcacttgagaagagcgatatcttcggcaaagaa
ccggatgaaatgcttgagctcattatggatcgcatcatcacaaaatataatgagaaggaa
gagcaattcggcaaagagcaaatgcgcgaattcgaaaaagttatcgttcttcgtgccgtt
gattctaaatggatggatcatattgatgcgatggatcagctccgccaagggattcacctt
cgtgcttacgcgcagacgaacccgcttcgtgagtatcaaatggaaggttttgcgatgttt
gagcatatgattgaatcaattgaggacgaagtcgcaaaatttgtgatgaaagctgagatt
gaaaacaatctggagcgtgaagaggttgtacaaggtcaaacaacagctcatcagccgcaa
gaaggcgacgataacaaaaaagcaaagaaagcaccggttcgcaaagtggttgatatcgga
cgaaatgccccatgccactgcggaagcgggaaaaaatataaaaattgctgcggccgtact
gaatag

DBGET integrated database retrieval system