KEGG   Bacillus subtilis subsp. subtilis 168: BSU35310Help
Entry
BSU35310          CDS       T00010                                 

Gene name
yvyD
Definition
(RefSeq) sigma-54 modulation protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S30AE Ribosom_S30AE_C TEX13 DUF4007 Aha1_N
Motif
Other DBs
NCBI-GeneID: 936715
NCBI-ProteinID: NP_391411
Pasteur: BG10740
BSORF: BG10740
UniProt: P28368
Position
complement(3631003..3631572)
Genome map
AA seq 189 aa AA seqDB search
MNYNIRGENIEVTPALKDHVERKIGKLERYFDHSVDADVNVNLKFYNDKESKVEVTIPMT
DLALRSEVHNEDMYNAIDLATNKLERQIRKHKTKVNRKFREQGSPKYLLANGLGSDTDIA
VQDDIEEEESLDIVRQKRFNLKPMDSEEAILQMNMLGHNFFVFTNAETNLTNVVYRRNDG
KYGLIEPTE
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaactataacatcagaggagaaaatattgaagtgacacccgcgttaaaggatcatgtc
gagaggaagatcggcaagctggagcgctattttgaccatagcgtggatgctgatgtgaac
gtcaacttgaagttttacaatgacaaggagtctaaggttgaggttacgattccgatgaca
gatctggcgcttcggtccgaggtgcataacgaggatatgtacaacgcaattgatctcgca
acaaacaaactggaacgtcaaatccgtaagcataaaacgaaagtaaaccgtaaattccgt
gagcagggctctccaaaatatttattggcaaacggtcttggctctgatacagatattgcg
gttcaggatgacatagaagaggaggagagcttggacatcgtccgtcagaaacgctttaat
ttaaagccgatggatagtgaagaagcgatcttgcaaatgaatatgctcggccataatttc
tttgttttcacaaatgcggaaacaaaccttacaaatgtcgtgtaccgcagaaatgacggg
aaatatggcttaattgaaccgactgaataa

DBGET integrated database retrieval system