KEGG   Bacillus subtilis subsp. subtilis 168: BSU35319
Entry
BSU35319          CDS       T00010                                 

Symbol
yvzG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 8303029
NCBI-ProteinID: YP_003097791
UniProt: C0H3R9 A0A6M4JPQ2
Position
complement(3631763..3632140)
AA seq 125 aa
MKSIEDYTLLSAYYHLLFTIEEGLCYLIEAEENLSKTEGDRIYQDLIQAFFYLDSTHSTL
LFIMDSRCAEICVKAFDQIFAEFDQLVSFSFPSHEFCEYLKEHFLIHYRKWMLSIHQCME
PFLIN
NT seq 378 nt   +upstreamnt  +downstreamnt
ttgaagagcattgaagattatacgcttttatcagcttattatcatcttctttttaccatc
gaagaggggttgtgttatttgatagaggctgaagagaatttatcaaaaacagaaggggat
cggatctaccaagatctgatccaagcctttttttatttggattcaacacattcaacactt
ctcttcattatggattcgcggtgtgctgaaatttgtgtgaaagcatttgaccaaattttt
gcggagtttgatcaattggtctctttctcttttccctctcatgagttctgtgagtattta
aaggaacattttctgattcattatagaaaatggatgctgtctattcatcaatgtatggaa
ccctttttaatcaattag

DBGET integrated database retrieval system