KEGG   Bacillus subtilis subsp. subtilis 168: BSU35319Help
Entry
BSU35319          CDS       T00010                                 

Gene name
yvzG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 8303029
NCBI-ProteinID: YP_003097791
UniProt: C0H3R9
Position
complement(3631763..3632140)
Genome map
AA seq 125 aa AA seqDB search
MKSIEDYTLLSAYYHLLFTIEEGLCYLIEAEENLSKTEGDRIYQDLIQAFFYLDSTHSTL
LFIMDSRCAEICVKAFDQIFAEFDQLVSFSFPSHEFCEYLKEHFLIHYRKWMLSIHQCME
PFLIN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
ttgaagagcattgaagattatacgcttttatcagcttattatcatcttctttttaccatc
gaagaggggttgtgttatttgatagaggctgaagagaatttatcaaaaacagaaggggat
cggatctaccaagatctgatccaagcctttttttatttggattcaacacattcaacactt
ctcttcattatggattcgcggtgtgctgaaatttgtgtgaaagcatttgaccaaattttt
gcggagtttgatcaattggtctctttctcttttccctctcatgagttctgtgagtattta
aaggaacattttctgattcattatagaaaatggatgctgtctattcatcaatgtatggaa
ccctttttaatcaattag

DBGET integrated database retrieval system