KEGG   Bacillus subtilis subsp. subtilis 168: BSU35340Help
Entry
BSU35340          CDS       T00010                                 

Gene name
fliD
Definition
(RefSeq) flagellar hook-associated protein 2
  KO
K02407  flagellar hook-associated protein 2
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU35340 (fliD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU35340 (fliD)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    BSU35340 (fliD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliD_C FliD_N Flagellin_IN DUF948 YojJ
Motif
Other DBs
NCBI-GeneID: 936728
NCBI-ProteinID: NP_391414
Pasteur: BG10921
BSORF: BG10921
UniProt: P39738
Position
complement(3632911..3634407)
Genome map
AA seq 498 aa AA seqDB search
MVTRITGLASGMDIDDIVSKLMQTERAPLDKLTQKKQTLEWQRDSYREVNSKIKELQDYM
SKNTLTYPSTYQSKTVTSSNESVLTATGSVSAPNSSSTVEVASLATAATYKANNYTGYTQ
GDYNLAFNVVAPGETTAKTVNISVTSADTIDNVISKLNSSDLGVSAFKDKIWNGTEYVET
IAFSSKATGAGGSIQAADSATADFMSGQLGFSLDADNKLTAYKEGTNAKVTINGFEMEKL
TNNFTVNGVTYSIKNTTAATGPVTTSVSTDVDGIYNQIKEFVDKYNELVDSLNEKLKEEK
YRDYTPLTSEQKEAMSDKEVELWEEKAKSGLLRNDSSISTGTNQMRTDFYTQVNADGKTY
QLTEFGITTSSAYQLRGHLEINEEKLKAKIAEDPQGVANLFTSGTNDSNYSDKGIMKRIT
NTLRSTVKSIEAKAGNSTMGASSYSIGKNLNSISTEITDMQDRLNTIENRYYSKFSAMDS
AIQKMNEQASYLSQLLVQ
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggtcacaagaataacaggtctggcgtcaggaatggatatagatgatatcgtatcaaag
ctgatgcagacagaaagagcgccgcttgataagctgacacaaaaaaagcagactcttgaa
tggcagcgtgacagctatcgtgaagtaaactcaaaaataaaagaattgcaagattatatg
tctaaaaatacgttgacatatccgagcacgtatcagagcaaaactgtgacaagctctaat
gagtctgtgttaactgctacaggaagcgtaagtgcgccaaattcttcgtctactgttgaa
gtggcgagcttggcaactgcagcaacgtataaggcaaacaattatacgggatacacacaa
ggcgattacaatttggcatttaacgttgttgcgcctggcgaaacaacagcaaaaacagtg
aacattagtgtgacgagtgccgatacgattgataatgtgatttctaaacttaacagctca
gatctaggagtatcagcatttaaagataaaatttggaatggtacagagtacgtagaaacg
attgcgttttcttctaaagcaacaggtgcaggaggaagcatacaggcagcagactctgct
acagctgactttatgtccggtcagcttggtttttctttggatgctgataataagcttact
gcttacaaagaaggcacaaatgccaaagtcacaatcaacggctttgaaatggagaagctg
acaaacaatttcacggtgaatggtgttacttattcgattaaaaatacaactgcagccaca
ggccctgttaccacatctgtttctactgatgttgatgggatttataaccaaatcaaagag
tttgtagataaatacaatgaactggttgacagcctgaatgaaaagctgaaagaagaaaaa
taccgagactatacgccactcacgagtgaacaaaaagaagccatgtccgataaagaggta
gagctctgggaggagaaggcgaaaagcggattgctgagaaacgattcaagcatcagcact
ggcacgaaccaaatgcggactgacttttatactcaagtgaatgcggatgggaaaacctat
caattaactgaatttggcatcacaacttcaagtgcttaccaactgcgagggcacttagag
attaacgaagagaaattgaaagcaaaaatagcagaagatcctcaaggagttgctaatctt
tttacaagtggaacaaatgatagtaactatagcgataaaggtattatgaagcggattact
aatacacttagaagtactgtgaaaagtattgaagctaaagctgggaactcgacaatggga
gctagtagctattccattggaaaaaatttaaactcgataagtactgaaataactgatatg
caggacagattgaataccatagaaaaccgctattattcaaaattcagtgcaatggattct
gcgattcaaaaaatgaacgaacaagcgtcctatttatcacagcttcttgtacaataa

DBGET integrated database retrieval system