KEGG   Bacillus subtilis subsp. subtilis 168: BSU35350Help
Entry
BSU35350          CDS       T00010                                 

Gene name
yvyC
Definition
(RefSeq) hypothetical protein
  KO
K06603  flagellar protein FlaG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU35350 (yvyC)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    BSU35350 (yvyC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlaG
Motif
Other DBs
NCBI-GeneID: 936737
NCBI-ProteinID: NP_391415
Pasteur: BG10920
BSORF: BG10920
UniProt: P39737
Structure
PDB: 

Position
complement(3634425..3634754)
Genome map
AA seq 109 aa AA seqDB search
MNIERLTTLQPVWDRYDTQIHNQKDNDNEVPVHQVSYTNLAEMVGEMNKLLEPSQVHLKF
ELHDKLNEYYVKVIEDSTNEVIREIPPKRWLDFYAAMTEFLGLFVDEKK
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
ttgaacattgaaaggctcactacgttacaacctgtttgggatcgttatgatactcaaata
cataatcagaaagataatgataacgaggttcctgttcatcaagtttcatataccaatctt
gctgaaatggtgggggaaatgaacaagcttttggaaccttcgcaagttcatctgaagttc
gagcttcatgacaagttaaatgaatactatgtaaaggtaatagaggactctacaaatgaa
gtgatccgcgaaattccaccaaaacggtggcttgatttttatgcggctatgactgaattt
cttgggttatttgtagatgaaaaaaagtag

DBGET integrated database retrieval system