KEGG   Bacillus subtilis subsp. subtilis 168: BSU35360Help
Entry
BSU35360          CDS       T00010                                 

Gene name
hag
Definition
(RefSeq) flagellin
  KO
K02406  flagellin
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU35360 (hag)
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU35360 (hag)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU35360 (hag)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    BSU35360 (hag)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flagellin_N Flagellin_C Vps5 Rh5 V-SNARE_C Spc7 CHDCT2
Motif
Other DBs
NCBI-GeneID: 936742
NCBI-ProteinID: NP_391416
Pasteur: BG10655
BSORF: BG10655
UniProt: P02968
Structure
PDB: 

Position
complement(3634987..3635901)
Genome map
AA seq 304 aa AA seqDB search
MRINHNIAALNTLNRLSSNNSASQKNMEKLSSGLRINRAGDDAAGLAISEKMRGQIRGLE
MASKNSQDGISLIQTAEGALTETHAILQRVRELVVQAGNTGTQDKATDLQSIQDEISALT
DEIDGISNRTEFNGKKLLDGTYKVDTATPANQKNLVFQIGANATQQISVNIEDMGADALG
IKEADGSIAALHSVNDLDVTKFADNAADTADIGFDAQLKVVDEAINQVSSQRAKLGAVQN
RLEHTINNLSASGENLTAAESRIRDVDMAKEMSEFTKNNILSQASQAMLAQANQQPQNVL
QLLR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagaattaaccacaatattgcagcgcttaacacactgaaccgtttgtcttcaaacaac
agtgcgagccaaaagaacatggagaaactttcttcaggtcttcgcatcaaccgtgcggga
gatgacgcagcaggtcttgcgatctctgaaaaaatgagaggacaaatcagaggtcttgaa
atggcttctaaaaactctcaagacggaatctctcttatccaaacagctgagggtgcatta
actgaaactcatgcgatccttcaacgtgttcgtgagctagttgttcaagctggaaacact
ggaactcaggacaaagcaactgatttgcaatctattcaagatgaaatttcagctttaaca
gatgaaatcgatggtatttcaaatcgtacagaattcaatggtaagaaattgctcgatggc
acttacaaagttgacacagctactcctgcaaatcaaaagaacttggtattccaaatcgga
gcaaatgctacacagcaaatctctgtaaatattgaggatatgggtgctgacgctcttgga
attaaagaagctgatggttcaattgcagctcttcattcagttaatgatcttgacgtaaca
aaattcgcagataatgcagcagatactgctgatatcggtttcgatgctcaattgaaagtt
gttgatgaagcgatcaaccaagtttcttctcaacgtgctaagcttggtgcggtacaaaat
cgtctagagcacacaattaacaacttaagcgcttctggtgaaaacttgacagctgctgag
tctcgtatccgtgacgttgacatggctaaagagatgagcgaattcacaaagaacaacatt
ctttctcaggcttctcaagctatgcttgctcaagcaaaccaacagccgcaaaacgtactt
caattattacgttaa

DBGET integrated database retrieval system