KEGG   Bacillus subtilis subsp. subtilis 168: BSU35370Help
Entry
BSU35370          CDS       T00010                                 

Gene name
csrA
Definition
(RefSeq) carbon storage regulator
  KO
K03563  carbon storage regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU35370 (csrA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bsu03019]
    BSU35370 (csrA)
Messenger RNA biogenesis [BR:bsu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     BSU35370 (csrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CsrA
Motif
Other DBs
NCBI-GeneID: 936731
NCBI-ProteinID: NP_391417
Pasteur: BG10654
BSORF: BG10654
UniProt: P33911
Structure
PDB: 

Position
complement(3636046..3636270)
Genome map
AA seq 74 aa AA seqDB search
MLVLSRKINEAIQIGADIEVKVIAVEGDQVKLGIDAPKHIDIHRKEIYLTIQEENNRAAA
LSSDVISALSSQKK
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgctagttttatcgcggaaaataaacgaagcgattcaaataggtgctgatattgaagta
aaagtgattgcggttgaaggggatcaagtgaagcttggaattgacgccccaaagcatatt
gatattcacaggaaagaaatttacttgaccattcaggaagaaaataaccgtgcagcagcg
ttatccagcgatgtgatctccgcattatcctcacaaaaaaagtga

DBGET integrated database retrieval system