KEGG   Bacillus subtilis subsp. subtilis 168: BSU35380
Entry
BSU35380          CDS       T00010                                 

Symbol
yviF
Name
(RefSeq) flagellar assembly factor FliW
  KO
K13626  flagellar assembly factor FliW
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU35380 (yviF)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Others
    BSU35380 (yviF)
SSDB
Motif
Pfam: FliW
Other DBs
NCBI-GeneID: 936732
NCBI-ProteinID: NP_391418
Pasteur: BG12451
BSORF: BG12451
UniProt: P96503 A0A6M4JPP0
Position
complement(3636264..3636695)
AA seq 143 aa
MIIHTKYHGQMNIKEEQIILFESGIPGFLEEKQFVILPLSEDSPFVALQSVTSENLAFIV
VSPFIFFKNYEFDLDESTAELLDIDNIQDVEVMTILTMAEPFEKSTANLLAPIIVNRKNM
MAKQVVLHDSSYTTKHPIGGESC
NT seq 432 nt   +upstreamnt  +downstreamnt
atgatcattcatacgaagtaccatggccaaatgaacataaaagaagaacaaatcattctt
tttgaaagcgggattccaggctttttagaagaaaaacagttcgtcatacttccgctttca
gaagactctccattcgtggcactgcagtccgtcacttcagaaaatcttgcgtttatcgtc
gtaagtccgtttatcttttttaagaattatgaatttgatcttgatgaatcaactgctgaa
cttttggatatcgataatattcaagacgtagaagtcatgacaatattgactatggcagag
ccatttgaaaagtctactgcgaatttattggctcccattattgtgaatcgcaagaacatg
atggctaagcaagtcgttttacacgactcctcatatacgacaaagcatccgattggagga
gaatcatgctag

DBGET integrated database retrieval system