KEGG   Bacillus subtilis subsp. subtilis 168: BSU35380Help
Entry
BSU35380          CDS       T00010                                 

Gene name
yviF
Definition
(RefSeq) flagellar assembly factor FliW
  KO
K13626  flagellar assembly factor FliW
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU35380 (yviF)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    BSU35380 (yviF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliW
Motif
Other DBs
NCBI-GeneID: 936732
NCBI-ProteinID: NP_391418
Pasteur: BG12451
BSORF: BG12451
UniProt: P96503
Position
complement(3636264..3636695)
Genome map
AA seq 143 aa AA seqDB search
MIIHTKYHGQMNIKEEQIILFESGIPGFLEEKQFVILPLSEDSPFVALQSVTSENLAFIV
VSPFIFFKNYEFDLDESTAELLDIDNIQDVEVMTILTMAEPFEKSTANLLAPIIVNRKNM
MAKQVVLHDSSYTTKHPIGGESC
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgatcattcatacgaagtaccatggccaaatgaacataaaagaagaacaaatcattctt
tttgaaagcgggattccaggctttttagaagaaaaacagttcgtcatacttccgctttca
gaagactctccattcgtggcactgcagtccgtcacttcagaaaatcttgcgtttatcgtc
gtaagtccgtttatcttttttaagaattatgaatttgatcttgatgaatcaactgctgaa
cttttggatatcgataatattcaagacgtagaagtcatgacaatattgactatggcagag
ccatttgaaaagtctactgcgaatttattggctcccattattgtgaatcgcaagaacatg
atggctaagcaagtcgttttacacgactcctcatatacgacaaagcatccgattggagga
gaatcatgctag

DBGET integrated database retrieval system