KEGG   Bacillus subtilis subsp. subtilis 168: BSU35390Help
Entry
BSU35390          CDS       T00010                                 

Gene name
yviE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 936735
NCBI-ProteinID: NP_391419
Pasteur: BG12450
BSORF: BG12450
UniProt: P96502
Position
complement(3636716..3637291)
Genome map
AA seq 191 aa AA seqDB search
MQIPRLIMHSVQGKIGLTTTPASLKMEQPQADLEIEQPSAEMEISVTPGKLTIDQTQAWE
ELDRKHVFKRIEEAAQQGHEDVMEGIARTAEEGDELMKIENKGNPIASQARRNSEMHQIQ
LGENYAPSLSRVKIQYTPSQLDVQITPRKPVIQAEPHKPIVEYTPGNVKVDMLQYPDLNI
DVEYPKESPEK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcagattcccagattgattatgcatagtgttcaaggaaaaattggtttaacaacgacg
cctgccagcttaaaaatggagcagcctcaagctgatctagagatcgaacagccgagtgcg
gaaatggaaatatcggtgacacctggaaaactcacgattgaccagacacaagcatgggaa
gaattagacagaaagcatgttttcaagagaattgaagaagccgcccaacaagggcatgag
gatgtaatggagggaatagcacgcactgcagaagaaggcgacgagcttatgaagattgaa
aataaggggaacccaatcgcttcacaagcaaggaggaactctgaaatgcaccaaattcaa
ttaggcgaaaattatgctccttctctttcgagggtgaaaatacaatatactccgtcacag
cttgatgtgcagattacgccgcgaaagcctgttattcaggctgagccgcataagccaatt
gttgaatatacgccaggaaatgttaaggttgacatgcttcaataccctgatttaaatata
gatgtagaatacccgaaagaatcacccgaaaagtaa

DBGET integrated database retrieval system