KEGG   Bacillus subtilis subsp. subtilis 168: BSU35390
Entry
BSU35390          CDS       T00010                                 

Symbol
yviE
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF6470
Other DBs
NCBI-GeneID: 936735
NCBI-ProteinID: NP_391419
Pasteur: BG12450
BSORF: BG12450
UniProt: P96502 A0A6M4JPM0
Position
complement(3636716..3637291)
AA seq 191 aa
MQIPRLIMHSVQGKIGLTTTPASLKMEQPQADLEIEQPSAEMEISVTPGKLTIDQTQAWE
ELDRKHVFKRIEEAAQQGHEDVMEGIARTAEEGDELMKIENKGNPIASQARRNSEMHQIQ
LGENYAPSLSRVKIQYTPSQLDVQITPRKPVIQAEPHKPIVEYTPGNVKVDMLQYPDLNI
DVEYPKESPEK
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagattcccagattgattatgcatagtgttcaaggaaaaattggtttaacaacgacg
cctgccagcttaaaaatggagcagcctcaagctgatctagagatcgaacagccgagtgcg
gaaatggaaatatcggtgacacctggaaaactcacgattgaccagacacaagcatgggaa
gaattagacagaaagcatgttttcaagagaattgaagaagccgcccaacaagggcatgag
gatgtaatggagggaatagcacgcactgcagaagaaggcgacgagcttatgaagattgaa
aataaggggaacccaatcgcttcacaagcaaggaggaactctgaaatgcaccaaattcaa
ttaggcgaaaattatgctccttctctttcgagggtgaaaatacaatatactccgtcacag
cttgatgtgcagattacgccgcgaaagcctgttattcaggctgagccgcataagccaatt
gttgaatatacgccaggaaatgttaaggttgacatgcttcaataccctgatttaaatata
gatgtagaatacccgaaagaatcacccgaaaagtaa

DBGET integrated database retrieval system