KEGG   Bacillus subtilis subsp. subtilis 168: BSU35400Help
Entry
BSU35400          CDS       T00010                                 

Gene name
flgL
Definition
(RefSeq) flagellar hook-associated protein 3
  KO
K02397  flagellar hook-associated protein 3 FlgL
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU35400 (flgL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU35400 (flgL)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    BSU35400 (flgL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flagellin_N Flagellin_C DUF2408 YvbH_ext
Motif
Other DBs
NCBI-GeneID: 936738
NCBI-ProteinID: NP_391420
Pasteur: BG11936
BSORF: BG11936
UniProt: P96501
Position
complement(3637338..3638234)
Genome map
AA seq 298 aa AA seqDB search
MRVTQGMIQQNSLRYIGSSYSKLDKLQSQISSGKKISKASDDPVVAMKSLKYNTQLSQVQ
QYKSNASQAFTWLENTETNITEGIDILSKVRELAVEAQNDTNGEPERQAIGVEVKQLKEQ
LLNIANTQVNGRYIFNGTNSDKPPVTDNGDGTYTISDTADVVVNISNNMSLKVNSDPKSA
FGGTSESGQNVFEMLDSFEKALNSGSLDGMDSVLNDIDHFSDGMSAERSDLGARYNRLEL
VNTRLSAQEETATKVLSDNEDVELEEVITEFIAQQSVHRATLAVNAQIVQPTLIDFLK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaacacaaggcatgatacagcaaaactcactgagatatatcggttcaagctac
tcgaagctggataaactccagtcgcagatttcttcaggaaaaaaaatctcaaaagcttcc
gacgatcctgtagtagcaatgaaaagcttaaagtataatacgcaactgtctcaagtgcag
cagtacaaaagcaatgcttctcaagcctttacctggctcgaaaacacagaaacaaacatt
acagaaggaattgacatcttgtcaaaggtcagagaattagcggttgaagctcaaaatgat
acaaacggcgagccggagcggcaagcgattggcgtagaggtaaagcagttaaaggaacag
cttttaaatattgcgaatacacaagtgaacggcagatatatctttaatggcacaaattca
gataagcctccggttacagataacggagacggaacttatacaatttctgatacagctgat
gtcgtagtcaatatatcaaataatatgtcattgaaagtgaattcagatccaaagtcagct
tttggaggcacttctgaaagcgggcagaatgtatttgaaatgcttgattcttttgagaaa
gcactaaattctggttcgctagatggcatggacagtgttttaaatgatattgatcatttt
tctgacggcatgagcgctgaacgatctgatcttggagcgagatataatcgtcttgaactg
gttaatacaagactgtcagcgcaagaagaaacagctaccaaagtgttatcagacaatgaa
gatgtagaactggaagaagtaataactgaatttattgcgcagcaaagtgtgcacagggct
actctggccgttaatgcgcaaattgttcagcctacattgattgactttttaaagtaa

DBGET integrated database retrieval system