KEGG   Bacillus subtilis subsp. subtilis 168: BSU35410Help
Entry
BSU35410          CDS       T00010                                 

Gene name
flgK
Definition
(RefSeq) flagellar hook-associated protein 1
  KO
K02396  flagellar hook-associated protein 1 FlgK
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU35410 (flgK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU35410 (flgK)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    BSU35410 (flgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flg_bbr_C Flg_bb_rod EDR1 Lectin_N Fmp27_WPPW
Motif
Other DBs
NCBI-GeneID: 936736
NCBI-ProteinID: NP_391421
Pasteur: BG10401
BSORF: BG10401
UniProt: P39810
Position
complement(3638245..3639768)
Genome map
AA seq 507 aa AA seqDB search
MTSTFMGLETARRALSAQQAALSTTANNVANANTDGYTRQRVSLEATDYFPAVSKNAEKT
AGQMGTGVQGKSVERIRDIFLDYQYRLQNNSAGYYDTKAKALSQMEGVLNETDDSGLNSV
LNSFWNSLQELSNNTNEESARSVVARKGQAVAETFNYISESLTNVQSNLKAELNTTVLDV
NSLLSQLNSLNKQIAQVEPVGLLPNGLYDQRDLLIDKLSSMVDIKVSYNKSGGNALASAE
GTVSIEILDKNKQSLGTVLDGKNYEVSELAANYDNETGLVSSISIGDTAVQAESFSSKGS
LLGFIESYGYITADGQEKGVYPEMLSDLDNMALEFAKAFNEVHRNGVTKSGEQGGDFFDF
TGGETEPAKGAAGKIKVADSIIDSKGANIAFSLTGAANDNANATKLANVLTGKITINGKE
TSVLDYYAGLIGELGIEAQEANRLASNTETQLNDADINRQQMSAVSLDEEMTNMIQFQHA
YNAAARMVTLQDELLDKVINGMGVGGR
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacatctacctttatggggcttgaaactgcaaggcgggcgttaagcgctcagcaggca
gcgttaagcactactgcaaataacgtggcaaatgccaatactgatggttatacaagacag
cgggtctcattggaggcaactgactatttccctgctgtatctaaaaatgcagaaaaaaca
gcgggacaaatgggtacgggcgttcaaggaaaatcagttgagagaataagagatatcttt
cttgactaccaataccgtcttcaaaacaacagtgccggatactatgacacgaaggcaaaa
gcgctgtcccaaatggaaggcgttttaaatgaaacggatgacagcggcttgaacagtgtg
ctcaattcgttttggaattccctgcaggaattatcgaataatacaaatgaagaaagtgca
cgttctgttgttgctcgaaaaggacaagctgtagctgaaacgtttaattatatttctgaa
tcacttacaaatgtccaatcgaatttaaaagcagagctaaatacaactgtgttggatgtc
aattctctgctttctcagttaaacagtttaaataagcaaattgcacaagtagagccggtc
gggcttcttccgaatggcttatatgaccagcgagatttgctgatcgataaattatcctca
atggttgatatcaaagtcagctacaacaaatcaggcgggaatgcacttgcatctgctgaa
ggaactgtatcaattgaaatccttgataaaaataaacagtcgctaggaactgttttggac
ggtaaaaattacgaggtttcagaacttgcagccaactatgataatgaaactgggttagta
tcaagtatttcaatcggggatacagctgtacaggcggagtcctttagcagcaagggatcc
cttttagggtttatagagtcttatgggtatataacagcagatggccaagaaaagggcgta
tacccggaaatgctttctgatcttgacaatatggcgcttgaattcgcgaaagctttcaat
gaagtgcacagaaatggtgtgaccaagagcggtgaacaaggcggagacttttttgatttt
actggcggtgaaactgaacctgccaagggcgcggcgggcaagatcaaagtggctgacagc
ataatagattcaaaaggcgcaaacattgctttctcactgactggcgcagccaacgataac
gcaaatgctacaaaattagcaaatgttttaaccggtaaaataaccattaacggtaaagaa
actagtgttttagattattatgcgggtctgattggcgagctagggatcgaagctcaagag
gctaatcgactggcgtctaatacagaaacacagctgaatgatgctgacataaaccgtcag
caaatgagcgcagtttctttagacgaagaaatgacgaatatgattcaattccaacacgca
tacaatgcagctgcaagaatggtgactttacaagacgaattgcttgataaagtgatcaac
ggcatgggtgttggaggaaggtag

DBGET integrated database retrieval system