KEGG   Bacillus subtilis subsp. subtilis 168: BSU35420
Entry
BSU35420          CDS       T00010                                 

Symbol
yvyG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: FlgN LPD5 YkuI_C Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 936745
NCBI-ProteinID: NP_391422
Pasteur: BG10400
BSORF: BG10400
UniProt: P39808 A0A6M3ZL52
Position
complement(3639787..3640269)
AA seq 160 aa
MSAKAIIEQLKRLCVLHEHLLTLSEEKTEALKAGKTKELSNILTKEQKYIQAITQTEDDR
IKTTSAFLGYSENNTISACIAKTSGSEKEELEQLYESLSQVLGRLKKVNEMNRQLTRDAL
QFISISYDMLVPKENNFNYSKSIKAELPKSSKMKLFDSKA
NT seq 483 nt   +upstreamnt  +downstreamnt
atgtcagcgaaggcaattattgaacaattgaagcgactttgcgttctgcatgagcacctg
ctcacgctgtctgaagaaaagacggaagcgctcaaagccggcaaaacaaaagagctttct
aacattttgacaaaagagcaaaaatatattcaagcaatcacgcagacagaagatgaccgg
atcaaaacaacttcggcctttctcggatatagcgaaaataatactatttccgcatgtatc
gccaaaacctcaggcagtgaaaaggaagagctggaacaactatacgaatctctttctcaa
gttctcggacgtctgaaaaaagtaaatgagatgaataggcagctgacaagagacgcgctg
caattcatctctatttcgtacgatatgctggttcctaaggaaaataacttcaattacagc
aaatcaattaaagctgagctgccgaaaagtagcaaaatgaaactgtttgattcaaaagct
tag

DBGET integrated database retrieval system