KEGG   Bacillus subtilis subsp. subtilis 168: BSU35420Help
Entry
BSU35420          CDS       T00010                                 

Gene name
yvyG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlgN YkuI_C DUF3531
Motif
Other DBs
NCBI-GeneID: 936745
NCBI-ProteinID: NP_391422
Pasteur: BG10400
BSORF: BG10400
UniProt: P39808
Position
complement(3639787..3640269)
Genome map
AA seq 160 aa AA seqDB search
MSAKAIIEQLKRLCVLHEHLLTLSEEKTEALKAGKTKELSNILTKEQKYIQAITQTEDDR
IKTTSAFLGYSENNTISACIAKTSGSEKEELEQLYESLSQVLGRLKKVNEMNRQLTRDAL
QFISISYDMLVPKENNFNYSKSIKAELPKSSKMKLFDSKA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgaaggcaattattgaacaattgaagcgactttgcgttctgcatgagcacctg
ctcacgctgtctgaagaaaagacggaagcgctcaaagccggcaaaacaaaagagctttct
aacattttgacaaaagagcaaaaatatattcaagcaatcacgcagacagaagatgaccgg
atcaaaacaacttcggcctttctcggatatagcgaaaataatactatttccgcatgtatc
gccaaaacctcaggcagtgaaaaggaagagctggaacaactatacgaatctctttctcaa
gttctcggacgtctgaaaaaagtaaatgagatgaataggcagctgacaagagacgcgctg
caattcatctctatttcgtacgatatgctggttcctaaggaaaataacttcaattacagc
aaatcaattaaagctgagctgccgaaaagtagcaaaatgaaactgtttgattcaaaagct
tag

DBGET integrated database retrieval system