KEGG   Bacillus subtilis subsp. subtilis 168: BSU35430Help
Entry
BSU35430          CDS       T00010                                 

Gene name
flgM
Definition
(RefSeq) negative regulator of flagellin synthesis
  KO
K02398  negative regulator of flagellin synthesis FlgM
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU35430 (flgM)
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU35430 (flgM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU35430 (flgM)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Regulation
    BSU35430 (flgM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlgM Mt_ATP-synt_D
Motif
Other DBs
NCBI-GeneID: 936739
NCBI-ProteinID: NP_391423
Pasteur: BG10399
BSORF: BG10399
UniProt: P39809
Position
complement(3640285..3640551)
Genome map
AA seq 88 aa AA seqDB search
MKINQFGTQSVNPYQKNYDKQAVQKTVAQPQDKIEISSQAKEMQHASDAVTGSRQEKIAQ
LKAQIENGSYKVDANHIAKNMINFYKKQ
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaatcaatttggaacacaatccgttaatccatatcaaaaaaattatgataag
caagcggtgcaaaaaactgttgcacaacctcaagataaaattgaaatttcatcacaggct
aaagaaatgcaacatgcatccgacgcagtcactggttcacgacaggaaaaaattgcgcag
cttaaagcgcaaattgaaaacgggtcatacaaagtagacgcaaatcatattgcgaaaaat
atgattaatttttataaaaagcaataa

DBGET integrated database retrieval system