KEGG   Bacillus subtilis subsp. subtilis 168: BSU35440
Entry
BSU35440          CDS       T00010                                 

Symbol
yvyF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: zinc-ribbons_6 DZR DUF2688 DZR_2 zf-C4pol zf-ribbon_3 SAND DEDD_Tnp_IS110 YkuI_C TackOD1 zf_UBZ
Other DBs
NCBI-GeneID: 936743
NCBI-ProteinID: NP_391424
Pasteur: BG10398
BSORF: BG10398
UniProt: P39807 A0A6M3ZGH6
Position
complement(3640632..3641051)
AA seq 139 aa
MGELANCPKCNALFLKTKLQTVCQACIKEEEKSFETVYKFLRKQENRQSTLSRITEETGV
EEELILKFIRQKRIQITHLPNLAYPCERCGTSIREGKFCKACQSDIKDQMDHLNHEDALK
IEKENSKKDTYYAYNTKNS
NT seq 420 nt   +upstreamnt  +downstreamnt
atgggagaactggctaattgtccgaaatgcaatgctttatttttaaaaacaaagctgcaa
accgtatgtcaggcgtgtattaaggaagaagaaaaatcatttgagactgtctataaattt
ttaagaaaacaggaaaaccggcaatcaactttgagccggataactgaggaaacaggtgtg
gaagaagagctgatattgaaattcatcaggcagaagcgaattcagatcactcatcttcct
aatttggcatacccttgtgaaaggtgcgggacatcgattagagaaggcaagttctgcaag
gcttgccagtctgatattaaggatcaaatggatcatttgaaccacgaggatgctctgaaa
atcgagaaagaaaatagtaaaaaagacacatactatgcctataataccaaaaacagctga

DBGET integrated database retrieval system