KEGG   Bacillus subtilis subsp. subtilis 168: BSU35440Help
Entry
BSU35440          CDS       T00010                                 

Gene name
yvyF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zinc-ribbons_6 DZR zf-C4pol DUF2688 zf-ribbon_3 SAND TackOD1 DEDD_Tnp_IS110 zf_UBZ YkuI_C zf-C3HC4_3
Motif
Other DBs
NCBI-GeneID: 936743
NCBI-ProteinID: NP_391424
Pasteur: BG10398
BSORF: BG10398
UniProt: P39807
Position
complement(3640632..3641051)
Genome map
AA seq 139 aa AA seqDB search
MGELANCPKCNALFLKTKLQTVCQACIKEEEKSFETVYKFLRKQENRQSTLSRITEETGV
EEELILKFIRQKRIQITHLPNLAYPCERCGTSIREGKFCKACQSDIKDQMDHLNHEDALK
IEKENSKKDTYYAYNTKNS
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgggagaactggctaattgtccgaaatgcaatgctttatttttaaaaacaaagctgcaa
accgtatgtcaggcgtgtattaaggaagaagaaaaatcatttgagactgtctataaattt
ttaagaaaacaggaaaaccggcaatcaactttgagccggataactgaggaaacaggtgtg
gaagaagagctgatattgaaattcatcaggcagaagcgaattcagatcactcatcttcct
aatttggcatacccttgtgaaaggtgcgggacatcgattagagaaggcaagttctgcaag
gcttgccagtctgatattaaggatcaaatggatcatttgaaccacgaggatgctctgaaa
atcgagaaagaaaatagtaaaaaagacacatactatgcctataataccaaaaacagctga

DBGET integrated database retrieval system