KEGG   Bacillus subtilis subsp. subtilis 168: BSU35450
Entry
BSU35450          CDS       T00010                                 

Symbol
comFC
Name
(RefSeq) ComF operon protein 3
  KO
K02242  competence protein ComFC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU35450 (comFC)
Secretion system [BR:bsu02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components
   BSU35450 (comFC)
SSDB
Motif
Pfam: DZR_2 Pribosyltran DZR DUF5824 PRTase_2 Zn-ribbon_8
Other DBs
NCBI-GeneID: 936747
NCBI-ProteinID: NP_391425
Pasteur: BG10397
BSORF: BG10397
UniProt: P39147 A0A6M3ZH18
Position
complement(3641125..3641814)
AA seq 229 aa
MICLLCDSQFSQDVTWRALFLLKPDEKVCYSCRSKLKKITGHICPLCGRPQSVHAVCRDC
EVWRTRIRDSLLLRQNRSVYTYNDMMKETLSRFKFRGDAEIINAFKSDFSSTFSKVYPDK
HFVLVPIPLSKEREEERGFNQAHLLAECLDRPSHHPLIRLNNEKQSKKKKTERLLSECIF
DTKNNSAEGMNIILIDDLYTTGATLHFAARCLLEKGKAASVSSFTLIRS
NT seq 690 nt   +upstreamnt  +downstreamnt
ctgatctgtttattatgtgattcgcaattttctcaagatgttacatggagagcccttttt
ttactaaagcctgatgaaaaggtttgttattcttgcagaagcaaattaaagaaaatcaca
ggacatatctgccccctgtgcggcagacctcaatctgttcatgccgtatgcagggattgc
gaggtgtggagaacaaggatcagagacagtttgctattgcgtcaaaaccgttcagtttac
acatataatgatatgatgaaagaaacgctctcccgttttaaatttagaggagatgcagaa
atcataaatgcatttaaaagtgatttttcttcaaccttttctaaggtttaccccgataag
cattttgttcttgtacctattccgctgagcaaggaacgggaagaagagcgcggatttaac
caggcacatctcttggcagaatgtttagaccggccttcccaccatcccctcattcgcctg
aataatgagaaacagtcaaagaaaaagaaaacagaacgcctgctgtcagagtgcattttt
gatacaaaaaataattcagcagaaggtatgaatatcattttaatagacgatctttataca
acaggcgccaccttgcacttcgcagcccgctgcttattagaaaaaggaaaagccgcttca
gtgtcatcttttaccttgatcagaagctaa

DBGET integrated database retrieval system